KEGG   Sphingobium chlorophenolicum: Sphch_0667Help
Entry
Sphch_0667        CDS       T01522                                 

Definition
(GenBank) Tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sch  Sphingobium chlorophenolicum
Pathway
sch00260  Glycine, serine and threonine metabolism
sch00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sch01100  Metabolic pathways
sch01110  Biosynthesis of secondary metabolites
sch01130  Biosynthesis of antibiotics
sch01230  Biosynthesis of amino acids
Module
sch_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sphch_0667
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sphch_0667
Enzymes [BR:sch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sphch_0667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEG48362
UniProt: F6EYX0
Position
1:complement(707700..708941)
Genome map
AA seq 413 aa AA seqDB search
MTDTPTLPNSLRSQPDASGHFGPFGGRYVAETLMPLILELEKVYKEARQDPAFEAEFAEL
LRSYVGRPNPLYYAQRLTEALRAEAPAGKGAKIYLKREELNHTGAHKINNCIGQALLARR
MGKKKVIAETGAGQHGVATATVAALFGMECKIFMGAKDVERQKPNVFRMKLLGAEVIPVV
SGSQTLKDAMNDALRHWVSNVHDTFYIIGTAAGPHPYPELVRDFQSIIGREAREQILELE
GRLPDMLIAPVGGGSNAIGLFHPFLDDADVKMIGVEAAGEGLNGKHAASLAGGKSGILHG
NRTYLLQDEDGQITEAHSISAGLDYPGIGPEHSWLHEIGRVQYMPITDDEALASFQKLSA
LEGIIPALESAHAVASAEKVAPTLDADQILIVNLSGRGDKDIFTVASALGVEI
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacccccaccctgcccaacagcctgcgctcgcagcccgatgcctccggccat
ttcggcccgttcggcggccgctatgtcgccgaaacgctgatgccgctgatcctggagctg
gagaaggtctataaggaagcccggcaagacccggccttcgaagccgagttcgccgaattg
ctgcgcagctatgtcggccgccccaacccgctttattatgcgcagcgcctgaccgaagcc
ctccgcgccgaagcccccgcaggaaaaggcgcgaaaatctacctgaagcgcgaggaactg
aaccacaccggcgcgcacaagatcaacaattgcatcggccaggccctgctcgcccgccgc
atgggcaagaagaaggtgatcgccgaaaccggcgctggccagcacggcgtcgccaccgcg
accgtcgccgccctgttcggcatggaatgcaagatcttcatgggcgcgaaggatgtggag
cggcagaagcccaacgtcttccgcatgaagctgctgggcgcggaagtgatcccggtcgtc
tccggctcccagacgctgaaggacgcgatgaacgacgccctgcgccactgggtatcgaac
gtccacgacactttctacatcatcggcacggcggcaggcccgcacccctatcccgaactg
gtccgcgacttccagtcgatcatcggccgcgaagcgcgcgagcagatcctcgaactggaa
ggccgcctgcccgacatgctgatcgccccggtcggcggcggctccaacgccatcggcctg
ttccaccccttcctggacgatgccgacgtcaagatgatcggcgtcgaagcggcgggcgaa
gggctgaacggcaagcatgccgcaagcctcgcgggcggcaagtccggcatcctccacggc
aaccgcacctaccttctccaggacgaggacggccagatcaccgaagcgcacagcatttcg
gcgggcctcgactatcccggcatcggtcccgaacatagctggctgcacgaaatcggccgc
gtccaatatatgccgatcaccgacgacgaagcgctggccagcttccagaagctctccgcg
ctcgaaggcatcatccccgcgctcgaatccgcccacgcggtcgccagcgcggaaaaggtc
gcgccgacgctggacgcggatcaaatcctcatcgtcaacctctccggccgcggcgacaag
gacatcttcaccgtggcgagcgcattgggagtggagatatga

DBGET integrated database retrieval system