KEGG   Sphingobium chlorophenolicum: Sphch_0978Help
Entry
Sphch_0978        CDS       T01522                                 

Definition
endo-1,4-beta-xylanase (EC:3.2.1.8)
Orthology
K01181  
endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
sch  Sphingobium chlorophenolicum
Brite
Enzymes [BR:sch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     Sphch_0978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1060295..1061425
Genome map
AA seq 376 aa AA seqDB search
MRRREFLAGALALGACSPVPSSRAEAGISSEGLAAHARRSGRAFGAAIKSRQLREDPDFT
AAIARECDMVVQEYELKRGTTEPRPGKYDFSGADQIIAFAQKHGMRARGHALVWYAAQPK
WLEPALQQADRAGREKLMTSYIDVAMPRYAGRIGEWDVVNEAVEPNDGRADGMRAKSMWM
QAMGEDYIDIAFHHARATDPKATLFLTDFGLEHDSPRCERRRTAMLKLLDRLMARKVPVD
AVGIQGHLKPYKEAFNQALFARFLEDLNGYGLALSVTEFDVADKGGPPSPDKRDSEIAAV
AKAFLDVALDNPAMRSVLCWGLSDRYSWLSNYPDYKWPDGQLSRVLPLDGDMRRKPLWDA
IAAAFDAAPPMGRSRA
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcggcgcgaattcctggccggggcattggcgctgggggcctgctcaccggtgccg
tccagccgggcggaggccgggatttcgtccgagggccttgccgcccatgcgcgccggtcg
ggccgtgctttcggcgcggcgatcaagtcccgccagttgcgcgaagaccccgatttcacc
gccgccatcgcccgcgaatgcgacatggtggtccaggaatatgaactgaagcgcggcacc
accgaaccccggcccggcaaatatgatttcagcggcgcggatcagatcatcgccttcgcg
cagaaacatggcatgcgggcgcgcggtcatgcgctggtctggtatgcggcccagcccaaa
tggctggaaccagcgctgcaacaggccgacagagcgggccgcgaaaagctgatgaccagc
tatatcgacgtcgccatgccgcgctatgcgggcaggatcggcgaatgggacgtggtcaac
gaagcggtcgaacccaatgacgggcgcgccgacggcatgcgcgccaaaagcatgtggatg
caggcgatgggcgaggattatatcgacatcgcattccaccatgcgcgggcgaccgatccc
aaggcgaccctgttcctgaccgatttcgggctggagcatgactcgccccgctgcgagcgg
cggcggacggcgatgctgaagctgctcgaccggctgatggcgcgcaaggtgcccgtggat
gcggtgggcatacagggccatctgaaaccctataaggaggcgttcaaccaggcactgttc
gcccgtttcctggaggatctgaacggttatgggctggcgctgtcggtgacggaattcgat
gtcgcggacaagggcgggccgcccagtcccgacaagcgtgacagcgagatcgccgccgtg
gccaaggcctttctggacgtggcgctggacaatccggcgatgcggtccgtgctctgctgg
ggtctttcggaccgttatagctggctgtccaactatcccgattataaatggcctgacggc
cagctttcccgcgtgttgccgctggacggcgacatgcgccgcaagccgctgtgggacgcc
atcgccgccgccttcgacgccgcgccacccatggggagaagccgcgcatga

  All links  
No link information was found.   
DBGET integrated database retrieval system