KEGG   Sphingobium chlorophenolicum: Sphch_0996Help
Entry
Sphch_0996        CDS       T01522                                 

Definition
cytochrome c class I
Orthology
K08738  
cytochrome c
Organism
sch  Sphingobium chlorophenolicum
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Sphch_0996
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sphch_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1082615..1082989
Genome map
AA seq 124 aa AA seqDB search
MVSKFVALAVAMLIASPALAQAGDAAKGKAVFARCMACHSVDPGANRLGPSLAGVMGRTS
GTMAGFAYSPAMKNAKIRWDAKTLDAFLAKPTAKVPGSKMIFAGLPNPADRANLIAYLAR
ATKK
NT seq 375 nt NT seq  +upstreamnt  +downstreamnt
atggtttcgaaattcgtcgcacttgccgtcgccatgctgatcgcaagccccgcgctggcc
caggcgggcgacgccgccaagggcaaggcggtcttcgcccgttgcatggcctgccactcc
gtcgatccgggcgcgaaccggcttgggccgtcgctggccggggtgatgggccgcacatcg
ggcacgatggcgggtttcgcctattcccccgcgatgaagaacgccaaaatccgttgggac
gccaagacgctggacgcctttctggccaagccgaccgccaaggtgccgggcagcaagatg
atcttcgcgggcctgcccaatccggcggatcgcgccaatctgatcgcctatctggcccgc
gcgaccaagaaatga

DBGET integrated database retrieval system