KEGG   Sphingobium chlorophenolicum: Sphch_1077Help
Entry
Sphch_1077        CDS       T01522                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sphch_1077
Enzymes [BR:sch01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Sphch_1077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1168803..1169411)
Genome map
AA seq 202 aa AA seqDB search
MEYDPDAEAAGESVKIPVPADVADAIRTLIRWSGDDTGREGLLETPERVARAWKEYCRGY
GDDPAYHLSRIFQEVGGYDDIVLLKDIPFQSHCEHHMAPIVGVAHIAYLPGQYVVGISKL
ARVLHAFAHRLQVQERLTSEVANCIWEHLKPEGVAVVIEATHGCMTGRGVRTPNVVMKTS
RMLGVFRDDVKSREEVLKLIGA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggaatatgatcccgatgccgaagccgctggcgagtcggtcaagatcccggttccggcg
gacgtggccgatgcgatccgcacgctgatccgctggtccggcgacgatacggggcgggaa
gggctgctggaaacgcccgaacgcgtggcgcgcgcatggaaggaatattgccgcggctat
ggcgacgatccggcctatcacctctcgcgcatctttcaagaggtgggcggctacgacgat
atcgtcctgttgaaggacattccgttccagtcgcattgcgaacatcatatggcgcccatc
gtcggcgttgcccatatcgcctatctgcccggccaatatgtcgtgggcatatcgaaactg
gcccgtgtgttgcacgccttcgcgcaccggcttcaggtgcaggaacggctgacgtccgaa
gtcgccaactgcatctgggaacatctgaagcccgaaggcgtagcggtcgtcatcgaagcc
acccatggctgcatgaccggacgcggcgtgcgcacccccaatgtcgtcatgaagaccagc
cggatgctcggcgtcttccgcgacgatgtgaagagccgcgaagaagtgctgaagctgatc
ggcgcgtga

DBGET integrated database retrieval system