KEGG   Sphingobium chlorophenolicum: Sphch_1077Help
Entry
Sphch_1077        CDS       T01522                                 

Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sch00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1168803..1169411)
Genome map
AA seq 202 aa AA seqDB search
MEYDPDAEAAGESVKIPVPADVADAIRTLIRWSGDDTGREGLLETPERVARAWKEYCRGY
GDDPAYHLSRIFQEVGGYDDIVLLKDIPFQSHCEHHMAPIVGVAHIAYLPGQYVVGISKL
ARVLHAFAHRLQVQERLTSEVANCIWEHLKPEGVAVVIEATHGCMTGRGVRTPNVVMKTS
RMLGVFRDDVKSREEVLKLIGA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggaatatgatcccgatgccgaagccgctggcgagtcggtcaagatcccggttccggcg
gacgtggccgatgcgatccgcacgctgatccgctggtccggcgacgatacggggcgggaa
gggctgctggaaacgcccgaacgcgtggcgcgcgcatggaaggaatattgccgcggctat
ggcgacgatccggcctatcacctctcgcgcatctttcaagaggtgggcggctacgacgat
atcgtcctgttgaaggacattccgttccagtcgcattgcgaacatcatatggcgcccatc
gtcggcgttgcccatatcgcctatctgcccggccaatatgtcgtgggcatatcgaaactg
gcccgtgtgttgcacgccttcgcgcaccggcttcaggtgcaggaacggctgacgtccgaa
gtcgccaactgcatctgggaacatctgaagcccgaaggcgtagcggtcgtcatcgaagcc
acccatggctgcatgaccggacgcggcgtgcgcacccccaatgtcgtcatgaagaccagc
cggatgctcggcgtcttccgcgacgatgtgaagagccgcgaagaagtgctgaagctgatc
ggcgcgtga

DBGET integrated database retrieval system