KEGG   Sphingobium chlorophenolicum: Sphch_1081Help
Entry
Sphch_1081        CDS       T01522                                 

Definition
(GenBank) 3-hydroxybutyryl-CoA epimerase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sch  Sphingobium chlorophenolicum
Pathway
sch00071  Fatty acid degradation
sch00280  Valine, leucine and isoleucine degradation
sch00281  Geraniol degradation
sch00310  Lysine degradation
sch00362  Benzoate degradation
sch00380  Tryptophan metabolism
sch00410  beta-Alanine metabolism
sch00640  Propanoate metabolism
sch00650  Butanoate metabolism
sch00903  Limonene and pinene degradation
sch00930  Caprolactam degradation
sch01040  Biosynthesis of unsaturated fatty acids
sch01100  Metabolic pathways
sch01110  Biosynthesis of secondary metabolites
sch01120  Microbial metabolism in diverse environments
sch01130  Biosynthesis of antibiotics
sch01200  Carbon metabolism
sch01212  Fatty acid metabolism
Module
sch_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sphch_1081
   00650 Butanoate metabolism
    Sphch_1081
  Lipid metabolism
   00071 Fatty acid degradation
    Sphch_1081
   01040 Biosynthesis of unsaturated fatty acids
    Sphch_1081
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sphch_1081
   00310 Lysine degradation
    Sphch_1081
   00380 Tryptophan metabolism
    Sphch_1081
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sphch_1081
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sphch_1081
   00281 Geraniol degradation
    Sphch_1081
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sphch_1081
   00930 Caprolactam degradation
    Sphch_1081
Enzymes [BR:sch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Sphch_1081
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sphch_1081
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Sphch_1081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2 NAD_Gly3P_dh_N F420_oxidored 2-Hacid_dh_C Pyr_redox_2 UDPG_MGDP_dh_N XdhC_C Sacchrp_dh_NADP Shikimate_DH NAD_binding_8 DAO
Motif
Other DBs
NCBI-ProteinID: AEG48771
UniProt: F6EUQ3
Position
1:1173352..1175529
Genome map
AA seq 725 aa AA seqDB search
MQSINFDIDGDGIATLTIDVPGQSMNVIGPDFMADLDAAITRIASEEAIKGAVIASGKDS
GFMAGMDLKYFGSMLGSESGKAPSPAAIFDKVFVLNQLFRRLETCGKPVACAIEGTCVGG
GFELALACHRRVVGDSPKTQLGLPEILIGLFPGGGGSQRLPRIMGVQASLMYMLQGKLFR
PAEAAMMKVVDEVVPQGTAVEKAREWVKANPNASVQPWDVKGFKVPGGAGGFNPAFAQTM
AGALPMTLKQTQRNMNAPVALLSAVYEGITLPMDRAVRIESKYFAKVAADPQAANMIRSL
FVNKQAAERGARRPKDQPKAPTKKLAMLGAGMMGAGIATVAAQAGMEVVLFDRDQAYAEK
GKAHVEAVLQKRLGKGLTPEKMAETLARVTPTTDYAALAGADFVIEAVFEDVAIKAEVTK
KVEEVLGADVIFGSNTSTLPITKLARAWSKPENFIGVHFFSPVEKMPLVEIILGKETGPA
AIAKALDFVSQIRKTPIVVNDARGFYTSRCFATYVQEGVEMVAEGINPALIENAGRQLGM
PVGPLAVGDEVSLELGHKIMVAARKELGDAYVAQPSDAVMERMVGLGRLGRKSAKGWYDY
PEGGKKHLWPGLAEMFPRADVQPDVEAVKERLLYRQLIECARCFEEGVLETPEDGDIGAI
FGWGFAPYTGGPFSHMDTVGIGTVVAVLDRLAAAHGGRFAPTAQLREMAASGATFYRPVS
SRAAA
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcatcaatttcgacatcgacggcgacggcatcgccacgctgaccatcgacgtt
cccggccagtccatgaacgtcatcggcccggatttcatggccgatctggacgcggcgatc
acgcgcatcgcgtccgaggaggcgatcaagggcgcggtgatcgcgtcgggcaaggacagc
gggttcatggcgggcatggacctgaaatatttcgggtccatgcttggcagcgagagcggg
aaggccccctccccggctgcgatcttcgacaaggttttcgtgctgaaccagttgttccgg
cggctggaaacctgcggcaagccggttgcctgcgccatcgagggcacctgcgtcggtggc
gggttcgaactggcgctggcatgtcatcggcgcgtggtgggcgacagcccgaagacgcag
cttggcctgcccgaaatattgatcggcctgttccccggcggcggcgggtcgcagcgtctg
ccgcgcatcatgggcgtgcaggcgtcgctgatgtatatgttgcaggggaagctgttccgc
ccggctgaggcggcgatgatgaaggtcgtcgatgaggtcgtgccgcagggcacggcggtc
gaaaaggccagggaatgggtgaaggcgaaccccaacgcatcggtgcagccgtgggacgtc
aaggggttcaaggtgccgggcggcgcgggcgggttcaaccccgccttcgcgcagaccatg
gcgggcgcgctgccgatgacgctgaagcagacgcagcgcaacatgaacgcgccggtcgct
ctgctgtccgccgtctatgaaggaatcaccctgcccatggatcgcgccgttcggatcgag
agcaaatatttcgccaaggtcgcggccgacccgcaggcggcgaacatgatccgtagcctg
ttcgtcaacaagcaggcggccgagcgcggcgcgcggcgacccaaggaccagcccaaggcg
ccgacgaagaaactggccatgctgggcgcgggcatgatgggcgcggggatcgccaccgtg
gccgcgcaagcgggcatggaggtcgtgctgttcgaccgcgaccaggcctatgccgaaaag
ggcaaggcgcatgtcgaggcggtgttgcagaagcggctgggcaaggggctgacgccggag
aagatggcggagacgctggcccgcgtgacgccgaccaccgactatgcggcgctggccggg
gcggacttcgtgatcgaggcggtgttcgaggatgtcgccatcaaggcggaggtgacgaag
aaggtcgaggaagtgctgggcgcggacgtcatcttcgggtccaacacctccactttgccg
atcaccaagctggccagggcatggtcgaagccggagaatttcatcggcgtccacttcttc
tcgcccgtagagaagatgccgttggtggagatcatcctgggcaaggaaaccggcccggct
gccatcgccaaggcgctggatttcgtcagccagatcaggaagacgcccatcgtcgtcaat
gacgcgcgcggcttctacacctcgcgctgcttcgccacctatgtgcaggaaggcgtggag
atggtggccgaggggatcaatccggcgctgatcgaaaatgccgggcggcaactgggcatg
ccggtggggccgctggccgtgggggacgaggtttcgctggagctgggccacaagatcatg
gtcgcggcgcgcaaggaactgggcgacgcctatgtcgcgcagccgtccgacgcggtgatg
gagcggatggtcggactggggcggctggggcgcaagagcgccaagggctggtatgactat
cctgaaggcgggaagaagcatttgtggccggggctggcggagatgttcccccgcgccgac
gtgcagcccgatgtcgaggcggtgaaggagcggctgctctatcgacagttgatcgaatgc
gcccgctgtttcgaggaaggcgtgctggagacgccggaggacggggatatcggcgcgatc
ttcggctggggcttcgcgccttacaccggagggccgttcagtcatatggatacggtcggt
atcggtactgtcgtggcggtgctggatcggctggcggcggcgcatgggggacggttcgcc
cccaccgcgcagttgcgggagatggcggccagcggggcgaccttctaccggcccgtttcg
tcccgcgccgcggcatga

DBGET integrated database retrieval system