KEGG   Sphingobium chlorophenolicum: Sphch_1090Help
Entry
Sphch_1090        CDS       T01522                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sphch_1090
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sphch_1090
   00052 Galactose metabolism
    Sphch_1090
   00500 Starch and sucrose metabolism
    Sphch_1090
   00520 Amino sugar and nucleotide sugar metabolism
    Sphch_1090
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sphch_1090
   00524 Butirosin and neomycin biosynthesis
    Sphch_1090
Enzymes [BR:sch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sphch_1090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1184196..1185161
Genome map
AA seq 321 aa AA seqDB search
MTEIIAADIGGTNARFARAKLDARNVPTLGKVRKYKVADYPSLQACWAAFVEDEGGKLPH
SASIAFATAIGREVIKLTNSAWVIRPDTLDEELGLKHLRLVNDFEAVAHAVARLPKENLP
LLFGEDRPFPRDGGVTILGPGTGLGVAMIAFDDGEPHVIATEGGHLDFAPLDPLEEKILA
YLRDKFLRVSTERIVSGPGLNNIYKAMATIGHDRVVLMEDAELWQAAIDGTDAFARAAFE
RFCMAYGSVAGDLALAQGPHAVVLAGGLTQRMRALLPQSGFHQRFTAKGRFESLMKSVPI
RLALHDEIGLYGAAAAFREKK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagatcatcgcagccgatatcggcggcaccaatgcccgtttcgcccgcgccaaa
ctggatgcgcgcaatgttccgactttgggcaaggtgcgcaaatataaggtcgcggattat
cccagcctccaggcctgctgggcggcgttcgtggaggatgaggggggcaagctgccccat
tccgcctccatcgccttcgccaccgccatcgggcgggaggtgatcaagctgaccaacagc
gcctgggtgatccggcccgatacgctggacgaggaactgggcctgaagcatttgcggctg
gtcaatgatttcgaggcggtggcccatgccgtggcgcgtctgcccaaggaaaatctgccg
ctgctgttcggggaggacaggccctttccgcgggacggcggggtgacgatattggggccg
ggcacggggctgggcgtggcgatgatcgccttcgacgatggcgagccgcatgtcatcgcg
accgagggcgggcatctggactttgcgccgctggacccactggaggagaagatactcgcc
tatctgcgcgacaagttcctgcgcgtgtcgacggagcggatcgtgtcggggccgggcctg
aacaatatctacaaggcgatggcgaccatcggccatgatcgggtggtgctgatggaagat
gccgagctttggcaggcggccatcgacggcacggatgcattcgcgcgggcggcgttcgag
cgtttctgcatggcctatgggtcggtcgcgggcgatctggcgctggcgcaggggccgcat
gcggtggtgctggcgggcgggctgacgcagcggatgcgggcgttgctgccgcagagcggg
ttccaccagcgcttcaccgccaaggggcggttcgagagcctgatgaaatcggtgccgatc
cggctcgccttgcatgacgaaatcgggctgtacggcgcggccgccgcctttcgggagaag
aaataa

DBGET integrated database retrieval system