KEGG   Sphingobium chlorophenolicum: Sphch_1261Help
Entry
Sphch_1261        CDS       T01522                                 

Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sphch_1261
   01230 Biosynthesis of amino acids
    Sphch_1261
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sphch_1261
   00051 Fructose and mannose metabolism
    Sphch_1261
   00562 Inositol phosphate metabolism
    Sphch_1261
Enzymes [BR:sch01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Sphch_1261
Exosome [BR:sch04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Sphch_1261
  Exosomal proteins of bladder cancer cells
   Sphch_1261
  Exosomal proteins of melanoma cells
   Sphch_1261
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1364671..1365411)
Genome map
AA seq 246 aa AA seqDB search
MGRRKLVVGNWKMNGLRAQLGEVEAIGGLARDHAAVEVGLCLPATLIAAADGVKGGAFIG
AQDCHMKANGAHTGCLSAAMLVEAGASWTIVGHSERRQDQGETDADIAAKALAAKAAGLK
VILCVGESLDVRDAGNAEAVVSAQLLASLPEGAAADWLAIAYEPIWAIGTGRIPTMEAVA
TMHAALRAALASRIGADADAMRILYGGSMNGDNAAELLAIADVDGGLIGGASLTAEKFAP
VITAAA
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgggcaggcgcaagctggttgtcggcaactggaagatgaacggccttcgcgcccagttg
ggcgaagtggaggccattggcggcctggcccgcgaccatgcggcggtggaagtcggcctc
tgtctgcccgcgactctgatcgcggcggcggacggcgtgaagggcggggccttcatcggc
gcgcaggattgccatatgaaggccaatggcgcccacaccggctgcctgtccgccgcgatg
ctggtggaggccggggcaagctggaccatcgtcggccatagcgaacgccggcaggaccag
ggcgaaaccgacgccgacattgcggccaaggcgctggcggccaaggctgcgggcctgaag
gtcatcctctgcgtgggcgaaagcctggacgtccgcgacgcgggcaatgccgaagcggtg
gtgtccgcgcaactgctcgcctccctgccggaaggcgcggcggccgactggctggccatc
gcctatgaaccgatctgggccatcggcaccggccgcatccccaccatggaagcggtcgcc
acgatgcacgcggccttgcgcgccgcgctggccagccggatcggcgcggatgccgacgcc
atgcgaatcctctacggtggatcgatgaacggcgacaatgcggcggaattgctcgcgatt
gccgacgtcgacggcggcctgatcggcggcgccagcctgacggcggaaaaattcgccccc
gtcatcaccgcagcggcctaa

DBGET integrated database retrieval system