KEGG   Sphingobium chlorophenolicum: Sphch_1351Help
Entry
Sphch_1351        CDS       T01522                                 

Definition
2-oxoglutarate dehydrogenase E2 subunit dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sphch_1351
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sphch_1351
  Amino acid metabolism
   00310 Lysine degradation
    Sphch_1351
Enzymes [BR:sch01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Sphch_1351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1461732..1462964)
Genome map
AA seq 410 aa AA seqDB search
MATEVKVPTLGESVTEATVGQWLKKPGDAVKADEPIVSLETDKVAVDVPAPAAGVLGDIV
AKEGDTVEVGALLAYVNEGAAASAAPAAAPAAKAEAAAPAPAASAPAEDEEGGNLTLSPA
VRRLVLEHGLDPSKIKGSGKDGRLTKDDVVAAAAAGTAKAAASAPAAAPAAAPAAGPSRA
QERVKMTRLRQTVAKRLKEAQNNAALLTTYNDVDMTNVIEARAKYKDLFEKKHGVRLGFM
GFFAKAVCMALRDVPGVNAQIEGDEIVYNDFADISVAVSAPNGLVVPVIRNAESLSVAEI
EKTIGSFGKKAKDGTLTMDDMKGGTFTISNGGVFGSLLSSPIINPPQSAVLGLHRIEDRP
VVRDGQIVIRPMMYLALSYDHRLIDGREAVTFLVAVKNAIEDPTRLLIDL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgaagtcaaagtccccactctgggcgaatccgttaccgaagcaaccgtcggc
cagtggctgaagaagcccggcgatgccgtgaaggccgacgagcccatcgtctcccttgaa
accgataaggtcgcggtcgacgtgcctgcgcccgccgccggtgtgctgggcgatatcgtc
gccaaggaaggcgacacggtagaggtcggcgcgctgctggcctatgtgaacgagggcgcg
gccgcttcggctgcccctgccgccgcgcccgccgccaaggcggaggcggccgctccggct
cccgccgcctcggctccggccgaagacgaggaaggcggcaatctgaccctgtcgcccgcc
gtccgccgtctggtgctcgaacatggcctggaccccagcaagatcaagggctccggcaag
gatggccgtctgaccaaggacgatgtcgtcgccgctgccgccgccggtactgccaaggcc
gccgcttcggcgcctgccgctgcgcctgccgccgcgcccgccgctggccccagccgcgcg
caggagcgtgtcaagatgacccgcctgcgccagaccgtcgccaagcggctcaaggaagcg
cagaacaacgccgcgctgctcaccacctataacgacgtcgacatgaccaacgtcatcgag
gcgcgcgcgaaatataaagacctgttcgaaaagaagcatggcgtccgtctgggcttcatg
ggtttcttcgccaaggccgtctgcatggcgctgcgggacgtccccggcgtcaatgcgcag
atcgagggtgacgagatcgtctataatgatttcgccgacatctcggtcgccgtgtccgcg
ccgaacggcctggtcgtgccggtgatccgcaacgcggaatcgctgagcgtggccgagatc
gagaagaccatcggcagcttcggcaagaaggccaaggatggcacgctgaccatggatgat
atgaagggcggcaccttcaccatctccaatggcggcgtcttcggttcgctgctgtccagc
ccgatcatcaacccgccgcagtcggcggtgctgggcctccaccgcatagaggaccgcccg
gtcgtccgcgacggccagatcgtcatccgcccgatgatgtatctcgcgctcagctacgac
catcgcctgatcgacgggcgtgaggcggtgacttttctcgtcgcggtgaagaacgccatc
gaggatccgacccggctgctgatcgacctgtaa

DBGET integrated database retrieval system