KEGG   Sphingobium chlorophenolicum: Sphch_1364Help
Entry
Sphch_1364        CDS       T01522                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sphch_1364
Enzymes [BR:sch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sphch_1364
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1476686..1477603)
Genome map
AA seq 305 aa AA seqDB search
MDGRLDYWNAPDGWPLRRYRLGDGQRGRMLVLGGRGDMIEKYLEVIRHWADRGWAVTSFD
WRGQGGSGRLTDDPLCGHIDDFGQWIADLTAFAADWRAEGEGPTVIVAHSMGGHLLLRAL
AEGMAPPDAAVTVAPMMGVHSAPLPRWLAVAIAGMMCALGFDRKQAWTQKEDSERQRHMR
QKRLTHDPDRYADELWWRDHSRDVALGAPSWKWVAQALHSTRAMETHAGLERISVPLLIL
AARNDRLVSTLAIRRTAARVPGARLHVYGAEAAHEILRELDPVRLDALARIDDFLDEVAP
KRNHG
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggacgggcggctggattattggaacgccccggacggctggccgctgcggcgctacagg
ctgggcgacggccagcgcgggcggatgctggtgctgggcggccggggcgacatgatcgag
aaatatctcgaagtcatccgccattgggccgaccggggctgggccgtcaccagcttcgac
tggcgggggcaggggggatcggggcggctgaccgacgatccgctctgcggacatatcgat
gatttcggccagtggattgccgacctcaccgccttcgccgccgactggcgcgccgaaggg
gaggggccgaccgtgatcgtcgcgcacagcatgggcggccacctgctgctgcgcgccctg
gcggaggggatggcgccgcctgatgccgccgtgacggtcgcgccgatgatgggcgtgcac
agcgcgcccctgcccagatggctggccgtggcgattgccgggatgatgtgcgcgctgggc
ttcgaccggaagcaggcctggacgcagaaggaggattcggaacgccagcggcacatgcgg
cagaagcggctgacccatgatccggatcgctatgccgacgaactctggtggcgcgatcat
agccgcgatgtggcgttgggggcgccaagctggaaatgggtcgcgcaggcgctgcattct
acccgcgcgatggaaacgcatgcgggtttggagcggatatccgtgccgctgttgatcctg
gcggcgcggaacgaccggctggtgtcgactttggccatcaggcggacggcggcgcgggtg
ccgggcgcgcggctgcacgtctatggggccgaagcggcgcatgagatattgcgggagctt
gacccggtgcggctggacgcgctggcgcggatagacgactttctggatgaagtcgcgccg
aagcggaaccatggctga

DBGET integrated database retrieval system