KEGG   Sphingobium chlorophenolicum: Sphch_1428Help
Entry
Sphch_1428        CDS       T01522                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sch00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:sch00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1548524..1549966)
Genome map
AA seq 480 aa AA seqDB search
MRLGSLIEEQDAKLGAGASLDVPVSGFAIDNRKVAPGTVFGAFQGARMNGEDFIPAAVQA
GAVAVVARPEARVEGAIHIAHDNPRRLFAQLAARYFAPFPEMTVAVTGTNGKTSTVELTR
QLWRMLGHHSASIGTLGVTTSVDQVSTGLTTPDIVTFLSNMSGLKREGITHAAFEASSHG
LAQYRTEGLPVSAAAFTNLSRDHLDYHGDMDSYFEAKMRLFDGVVAPDGAAVVWADDEWS
DKVIRRATKRGLRVLSVGVQGQALRLANRTPTQLGQTLEVEVEGKPYKVSLPLIGAYQAA
NALTAAALVIAGGEDVGKVLELLGRVQPVRGRLERAVITRAGAPVYVDYAHTPDGLRAAI
EALRPHTKGRLITLFGAGGDRDAGKRPQMGKVAADLADHVIVTDDNPRSEEPSSIRAAVM
AGAPGAEEIGGRRAAIAAAIAQAGADDIVLLAGKGHEQGQIIGDRVLPFDDVTVARECAG
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctcgggtcgctgatcgaggagcaggatgcgaagctcggcgccggggcgtccctg
gacgtgccggtgtcgggctttgcaatcgataaccggaaggtcgcgccgggcactgtgttc
ggggccttccagggtgcgcggatgaatggtgaggatttcatccccgccgccgtgcaggcc
ggggccgtggcggtggtcgcccggcccgaagcaagggtcgaaggcgcgatccatatcgct
catgacaatccgcgccggcttttcgcgcaactggcggcacgctatttcgcgccctttccg
gagatgacggtcgccgtcaccgggaccaacggcaagacatccacggtggaactgacgcgc
caattatggcggatgctggggcatcattcggcctccatcgggactttgggcgtcaccacg
tcggtcgatcaggtgtcgactgggctgaccacgccggacatcgtgaccttcctgtccaac
atgtccggcttgaagcgtgagggcatcacccatgccgcgttcgaggcgtcgagccatggg
ctggcgcaatatcgcaccgaagggctgccggtttcggcggcggccttcaccaatctgtcg
cgggatcatctcgattatcatggcgacatggacagctatttcgaggccaagatgcggctg
ttcgacggagtggtcgcgcctgatggcgccgcggtcgtctgggcggacgatgaatggtcg
gacaaggttatccggcgggctacgaagcgggggcttcgtgtgctgagcgtcggggtgcag
gggcaggccttgcggcttgccaaccgcaccccgacccagttgggccagacgctggaagtc
gaggttgagggcaagccctacaaggtcagcctgccgctgatcggcgcctatcaggcggcc
aacgcgctgaccgccgccgcgctggtaatcgcgggcggcgaggatgtaggcaaggtattg
gaactgctgggccgggtgcagccggtgcgcgggcgtctggagcgggcggtgatcacgcgg
gccggtgcgccggtctatgtcgattatgcccatacgcccgatggcctgcgcgccgccata
gaggcgctgcggccgcatacgaagggcaggctgatcaccctgttcggcgcgggtggggat
cgcgatgcgggcaagcgtccgcaaatgggcaaggtcgccgccgacctggccgatcatgtg
atcgtgaccgatgacaatccgcgttcggaggaaccctcctccatccgcgccgccgtcatg
gcgggcgcgccgggggcggaggaaattggcggtcgccgcgcagccatcgccgccgccatt
gcgcaggcaggagcggatgatatcgtgctgctcgcgggcaagggacatgagcaggggcag
attatcggtgaccgggtgctcccttttgatgacgtgaccgtggcgcgggaatgcgccgga
tga

DBGET integrated database retrieval system