KEGG   Sphingobium chlorophenolicum: Sphch_1443Help
Entry
Sphch_1443        CDS       T01522                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
sch  Sphingobium chlorophenolicum
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sphch_1443
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Sphch_1443
Enzymes [BR:sch01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sphch_1443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1561176..1562189)
Genome map
AA seq 337 aa AA seqDB search
MKPVIFGLSGETLTTEERAFFAEAQPAGYILFRRNIADRAQLRALTDELRALHGRDDLLI
MIDQEGGRVARMQPPVWPSFPPGALFDRLYEIAPSSAIAAARANARAIATTLAEVGISVD
ALPLLDVRREGASDIMGDRTLGAEPMRVAALGRAVIEGLADGGVVGIVKHMPGHGRAMVD
SHHELPIVTADEDALSVDLAPFQALKDAPMGMTAHVVYTAWDPDLPASLSPSVIETIIRG
RIGFDGLLMSDDLDMKALKGSIPELAGATVAAGCDLALNCWGRMDDMVGIADLLPEMTPK
AMERLDRAMGSAHRLAEGPPLEELLATRDALLAPVMA
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccgttatcttcggcctttccggcgagacattgaccacggaggagcgcgccttc
ttcgcggaggcccagccggccggttatatcctcttccggcgcaatatcgccgacagggcg
cagcttcgggcgcttaccgacgaactgcgggcgctgcacgggcgcgatgacctgctcatc
atgatcgatcaggaaggcggccgggtggcgcggatgcagccgccggtctggccgagcttt
ccgcccggcgcgttgttcgaccggctctatgagatcgcgccttccagcgccatcgccgcc
gcccgcgccaatgcgcgcgccatcgcgaccacgctggcggaggtagggatcagcgtcgac
gccctgccactgctcgatgtgcggcgggaaggggcgagcgacatcatgggcgaccggacg
ctgggggccgaaccgatgcgggttgcggccctgggacgggcggtgatcgaagggctggcc
gatggcggcgtggttggcatcgtcaagcatatgccgggtcatggccgggcgatggtcgac
agccatcatgaactgcccatcgtgaccgccgacgaggatgcgttgtcggtcgatctggcg
ccgttccaggcgctgaaggacgcgcccatggggatgacggcccatgtcgtctataccgcc
tgggacccggatttgcccgccagcctgtctccttcggtgatcgagacgatcattcgcggg
cggatcggcttcgacgggctgttgatgtccgacgatctcgatatgaaggcgttgaagggc
agcattcccgaactggcgggggctacggtcgcggcagggtgtgatctggcgctcaattgc
tggggacggatggacgatatggtgggcattgcggatctgttgccggagatgacgcccaag
gccatggagcggctggatcgggcgatggggtccgcgcaccggctggcggagggtccgccg
ctcgaagaattgctcgccacccgcgatgcgttgctggcgccggtcatggcctga

DBGET integrated database retrieval system