KEGG   Sphingobium chlorophenolicum: Sphch_1529Help
Entry
Sphch_1529        CDS       T01522                                 

Definition
3-hydroxybutyrate dehydrogenase (EC:1.1.1.30)
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sch00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:sch00072]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1649329..1650120
Genome map
AA seq 263 aa AA seqDB search
MSKSLSGKTALITGSTSGIGLAYAKALAGEGANVVINGFGDADAIEKERVGLEALSGGKA
LYSGHDLTKADQIEAMMQEAADAFGGVDILINNAGMQHVAPVEEFPVDKWNLIIALNLNS
AFHTSRLAIPYMKQKKWGRIIQTASAHSLTASPYKSAYVTAKHGLAGLTKTLALELATFG
ITANCISPGYVWTPLVENQIPDTMKARGMTREQVMNDVLLAGQPTKQFVTVEQVASMALY
LCSDAAANITGANMSIDGGWTAQ
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagtccctgtcaggcaagaccgccctcatcaccggatcaacgtccggcatagga
ctggcctatgccaaggcgctggccggggaaggcgccaatgtggtgatcaacggctttggc
gacgcggacgcgatcgagaaggaacgggtcgggctggaggcgctgagcggggggaaggcg
ctctatagcggccatgatctgacgaaggccgaccagatcgaagcgatgatgcaggaagcc
gccgacgcgttcggcggcgtcgacatcctcatcaacaatgccgggatgcagcatgtcgcg
ccggtcgaggagtttccggtcgataaatggaacctgatcatcgcgctgaacctcaacagc
gccttccacacatcccgtctcgccattccttatatgaagcagaagaaatgggggcggatc
atccagacggcttcggcgcattcgctgaccgcttcgccctataagagcgcctatgtgacg
gcgaagcatgggctggcgggccttaccaagacgctggcgctggagctggcgaccttcggc
atcacggcgaactgcatctctcccggctatgtgtggacgccgctggtggagaatcagata
cccgacacgatgaaggcgcgcggcatgacgcgggagcaggtgatgaacgacgtgctgctc
gccgggcagccgaccaagcagttcgtgacggtggaacaggtggcgtcgatggccctctat
ctgtgcagcgatgccgccgccaacatcaccggcgcgaacatgagcatcgacggcggctgg
acggcgcaatag

DBGET integrated database retrieval system