KEGG   Sphingobium chlorophenolicum: Sphch_1544Help
Entry
Sphch_1544        CDS       T01522                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
sch  Sphingobium chlorophenolicum
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sch00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sphch_1544
DNA repair and recombination proteins [BR:sch03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Sphch_1544
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1663106..1663702)
Genome map
AA seq 198 aa AA seqDB search
MASPEIEALTQALSRLPGLGPRSARRAVLHLLKKRESALEPLLRALDAVNDRLVTCGICG
NVDTVDPCGICADPRRDARALCVVEDVADLWALDKSRLFPGRFHVLGGRLSALEGVRPED
LSIDALVARVEAGGIDEVVLAMNATLEGQTTAHYLAERLERFPVRLTQLAHGVPVGGELD
YLDEGTLAQALRARRPLG
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcttctcccgaaatcgaagcgctgacgcaggcgctctcccgcctgcccggccttggc
ccgcgatcggcgcggcgggccgtcctgcatctgctcaagaagcgcgaatccgcgctggag
cctctgttgcgcgcattggacgcggtgaacgaccggctggtgacgtgcggcatctgcggc
aatgtcgacacggtcgacccttgcggcatctgcgccgatccccggcgggatgcgcgggcg
ctctgcgtggtggaggatgtggcggacctgtgggcgctggacaagtcgcggctgtttccg
gggcgtttccatgtgctgggcgggcgcttgtcggcgctggagggcgtgcggccggaggat
ctttccatcgacgcgctggtggcgcgggtggaggcgggcggcatagacgaggtggtgttg
gcgatgaacgccacgctggaggggcagacgaccgcccattatctggccgaacggctggag
cgtttccccgtgcgtctcacccaattggcgcatggcgtgccggtggggggcgaactggac
tatctggatgaaggcacgctggcgcaggcgctgcgggcgcggcggccgctgggctga

DBGET integrated database retrieval system