KEGG   Sphingobium chlorophenolicum: Sphch_1580Help
Entry
Sphch_1580        CDS       T01522                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:sch00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sch00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:sch03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:sch03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sch03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1697196..1697633)
Genome map
AA seq 145 aa AA seqDB search
MQVDFYQLSRDPVEQVLPAIAGRILDMGARLLVVAQEPERLERISAGLWAGPPESFLAHG
RSGEGAESMQPVLLAADCAAANGARHIALADGLWREEALQFERAFYFFDSETIEGARASW
RDLSKREGVTPRFWRQEGRKWVQGP
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcgatttctaccagctcagccgcgatcccgtggaacaggtgctgcccgccata
gcgggccgcatcctggacatgggcgcgcgcctgctggtggtcgcgcaggagcctgaacgg
ctggagcgcatctccgccggactgtgggcggggccgccggaaagcttcctggcccatggc
cggtcaggggagggcgccgagtcgatgcagcccgtgctgctggcggcggattgtgccgcc
gctaacggagcacggcatatcgcattggcggacggcctctggcgggaggaagcgctgcaa
ttcgagcgggccttctatttcttcgactcggaaaccatcgaaggcgcgcgggcaagctgg
cgcgatctcagcaagcgcgagggggtgacgccccgtttctggcggcaggaaggccgcaaa
tgggtgcaaggcccttag

DBGET integrated database retrieval system