KEGG   Sphingobium chlorophenolicum: Sphch_1850Help
Entry
Sphch_1850        CDS       T01522                                 

Definition
long-chain-fatty-acid--CoA ligase (EC:6.2.1.3)
Orthology
K00666  
fatty-acyl-CoA synthase [EC:6.2.1.-]
Organism
sch  Sphingobium chlorophenolicum
Brite
Enzymes [BR:sch01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     Sphch_1850
Lipid biosynthesis proteins [BR:sch01004]
 Acyl-CoA synthetase
  Unknown
   Sphch_1850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1960874..1962541)
Genome map
AA seq 555 aa AA seqDB search
MTPDRTLSYRKGPTDGPLLNQTIGQALRRAALQWPDELALVSRHQRLRWTWRELDREVDR
VASGLLHLGIRKGDRVGIWAANCAEWAVIQFASARIGAILVTINPAYRVSEVEYVLAKAG
CSLLVTAARFKTSDYIAMLREIDPNAMPLLRIKVALGEEVQEGVLRWDDLRAEPDVPALT
ALEAALSPDDAINVQFTSGTTGFPKGATLTHRNILNNAHFTGRTINLTNADRICIPVPLY
HCFGMVLGNLAALTSGAAMVYPGEAYDPTLVLQAIEAEGCTALYGVPTMFIAILARTDLD
SYNVSTLRTGIMAGAPCPATTMRQVMDQLNMREITIGYGMTETSPLTTQTATDDPLEERA
GTVGRVHPHAEAKIVGPDGKTLPIGEQGEYCSRGYAVMQGYWDEPERTAEAIDADGWMHS
GDLAVMDEKGYIRITGRIKDMVIRGGENIYPREIEEFLLTHPQIQDAQVFGVADEKLGEE
VCAWVIAKPGAELSVDGVLAHCRGNIAHYKVPRHVRVVPRFPMTVTGKAQKFQMRKMMET
ELRIARGSPPLGEPQ
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atgacgccggaccggactctctcataccgcaagggcccgaccgacggtccattgctgaac
cagacgatcggacaggcgctgcgccgggcggcgctgcaatggccagacgaacttgccttg
gtctcacgccatcagcggttgcgctggacatggcgagaattggaccgggaagtcgatcgc
gtcgcaagcggactgctgcatcttggcatccgcaagggtgacagggtggggatatgggcc
gccaattgcgcggaatgggcggtcattcagttcgccagcgcgcgcatcggcgcgatcctc
gtcacgataaaccctgcctaccgtgtttccgaagtggaatatgtgcttgctaaggctgga
tgcagcttgctggttacagcggctcggttcaagaccagcgactatatcgcaatgctgcgc
gaaattgatccaaacgcaatgcccctactgcggatcaaggtggcgctgggcgaagaggtg
caggaaggcgtcctgcgctgggacgacttgcgcgccgagcccgacgtgcccgcgctgact
gcattggaggcggcgctgtcaccagacgacgccatcaacgtccagtttacaagcggaaca
accggctttccaaagggagcgacgctcacccaccgcaacatcctgaacaacgcgcatttc
accggccgcacgatcaacctgaccaatgccgaccgcatctgtatcccggtgcccttgtac
cattgtttcggcatggtgctgggcaaccttgcggcgctgaccagcggcgcggccatggtc
tatccgggcgaagcttacgatccgacgctggtgctgcaggccatcgaggcggaaggctgt
accgcactctacggcgtaccgactatgtttatagccattctcgcgcggaccgatctcgat
tcctacaacgtctcaaccctgcgcacggggatcatggccggtgcgccctgtcccgccacc
acgatgaggcaggtgatggaccagcttaacatgcgcgaaatcaccatcggctacggcatg
accgagacgagcccgctcaccacccagacagcaaccgacgatccgctagaggaacgggcc
ggcaccgtgggccgcgtccaccctcatgcggaggccaagattgtcggaccggatggcaag
accttgcccatcggcgagcagggcgagtattgctcgcgcggctatgccgtgatgcagggg
tactgggacgagccggagcggacagccgaagccatcgacgccgatggctggatgcactct
ggcgatctcgcagtgatggatgagaaaggctacatccgcatcactggtcggatcaaggat
atggtgatccggggcggcgagaatatctatccgcgcgagatagaggaattcctgctcaca
cacccgcaaatacaagacgcgcaggtttttggcgtggcggacgagaagttgggcgaggaa
gtctgtgcctgggtgatcgccaagccgggcgctgaactctctgtcgacggcgtgctggcc
cactgcagggggaatatcgcgcactacaaggtgccgcgccatgtgcgggtggtcccccgg
tttccgatgactgtgaccgggaaggcccagaagttccagatgcgcaaaatgatggagacg
gaactgcgtatcgcgcgcgggtcaccccctcttggggaaccgcagtga

DBGET integrated database retrieval system