KEGG   Sphingobium chlorophenolicum: Sphch_2016Help
Entry
Sphch_2016        CDS       T01522                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
sch  Sphingobium chlorophenolicum
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2148429..2149493
Genome map
AA seq 354 aa AA seqDB search
MDEPERQQRARAGSAANREIVRRRKLYEDIGDFLFAHDLDLTPLNFGVAHDYLTGSHIGV
EKAVKAVLAERGKITNGWIENVAADQRNDEVTPEALASMLDKVEENLSQFTGLMTESRNS
AKDYGAALQEEVKGLAASAENQPVLARLVSLTRSMVEKTRQVEGQLRDNQKQTQLLKSNL
ESARRAAEHDHLTGLPNRRAFEGTLREELERAHKEGQSLAVAFCDIDHFKLINDTHGHDT
GDRVLKFVAGLLAKASNDQCHVARHGGEEFVMLFRGKTAAEACEAVDSVRQDLSTRSLVN
RANGERMERVSFSAGVANVLAYEDPRAALKAADRALYLAKEHGRNRVYLAAELD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacgagccggagcggcagcagcgcgcccgcgcaggcagcgcggccaaccgggaaatc
gtccggcggcgcaagctgtacgaggatatcggcgatttcctcttcgcccatgatctggac
ctgacgccgctcaatttcggcgtcgcccacgactatctgaccggatcgcatatcggcgtg
gaaaaggccgtgaaggcggtgctggcggaacggggcaagatcaccaacggctggatcgaa
aatgtcgccgccgaccagcgcaatgacgaggtcacgcccgaagcgctcgcctccatgctc
gacaaggtcgaggagaatctgtcgcaattcaccggcctgatgacggaatcgcgcaattcg
gccaaggattatggcgcagcgttgcaggaagaggtgaaggggctggccgccagcgcggaa
aatcagccggtattggcgcgcctggtctcgctgacccgatcgatggtggaaaagacccgc
caggtcgaaggccagctacgcgacaatcagaagcagacgcaattgctgaaatccaacctg
gaaagcgcgcgccgcgccgccgagcacgatcatctgaccggcctgcccaaccgccgcgcc
ttcgaaggcacgctgcgcgaggaactggagcgggcgcataaggaagggcagtcgctggcc
gtcgccttctgcgacatcgatcatttcaagctgatcaacgatacccatggccatgatacc
ggcgaccgggtgctgaaattcgtcgccgggctgctggccaaggcgagcaacgaccaatgc
catgtcgcccgccacggcggcgaggaattcgtcatgctgttccgcggcaagacggcggcc
gaggcctgcgaggcggtggacagcgtgcggcaggacctgtccacccgcagcctggtcaac
cgggcgaacggcgaacggatggagcgggtgagcttttccgccggggtcgccaatgtgctg
gcctatgaagacccccgcgccgcgttgaaggcggcggaccgggcactctatctggccaag
gaacatggccgcaaccgggtgtatctggcggcggagctggattga

DBGET integrated database retrieval system