KEGG   Sphingobium chlorophenolicum: Sphch_2016Help
Entry
Sphch_2016        CDS       T01522                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
sch  Sphingobium chlorophenolicum
Brite
Enzymes [BR:sch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Sphch_2016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1:2148429..2149493
Genome map
AA seq 354 aa AA seqDB search
MDEPERQQRARAGSAANREIVRRRKLYEDIGDFLFAHDLDLTPLNFGVAHDYLTGSHIGV
EKAVKAVLAERGKITNGWIENVAADQRNDEVTPEALASMLDKVEENLSQFTGLMTESRNS
AKDYGAALQEEVKGLAASAENQPVLARLVSLTRSMVEKTRQVEGQLRDNQKQTQLLKSNL
ESARRAAEHDHLTGLPNRRAFEGTLREELERAHKEGQSLAVAFCDIDHFKLINDTHGHDT
GDRVLKFVAGLLAKASNDQCHVARHGGEEFVMLFRGKTAAEACEAVDSVRQDLSTRSLVN
RANGERMERVSFSAGVANVLAYEDPRAALKAADRALYLAKEHGRNRVYLAAELD
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggacgagccggagcggcagcagcgcgcccgcgcaggcagcgcggccaaccgggaaatc
gtccggcggcgcaagctgtacgaggatatcggcgatttcctcttcgcccatgatctggac
ctgacgccgctcaatttcggcgtcgcccacgactatctgaccggatcgcatatcggcgtg
gaaaaggccgtgaaggcggtgctggcggaacggggcaagatcaccaacggctggatcgaa
aatgtcgccgccgaccagcgcaatgacgaggtcacgcccgaagcgctcgcctccatgctc
gacaaggtcgaggagaatctgtcgcaattcaccggcctgatgacggaatcgcgcaattcg
gccaaggattatggcgcagcgttgcaggaagaggtgaaggggctggccgccagcgcggaa
aatcagccggtattggcgcgcctggtctcgctgacccgatcgatggtggaaaagacccgc
caggtcgaaggccagctacgcgacaatcagaagcagacgcaattgctgaaatccaacctg
gaaagcgcgcgccgcgccgccgagcacgatcatctgaccggcctgcccaaccgccgcgcc
ttcgaaggcacgctgcgcgaggaactggagcgggcgcataaggaagggcagtcgctggcc
gtcgccttctgcgacatcgatcatttcaagctgatcaacgatacccatggccatgatacc
ggcgaccgggtgctgaaattcgtcgccgggctgctggccaaggcgagcaacgaccaatgc
catgtcgcccgccacggcggcgaggaattcgtcatgctgttccgcggcaagacggcggcc
gaggcctgcgaggcggtggacagcgtgcggcaggacctgtccacccgcagcctggtcaac
cgggcgaacggcgaacggatggagcgggtgagcttttccgccggggtcgccaatgtgctg
gcctatgaagacccccgcgccgcgttgaaggcggcggaccgggcactctatctggccaag
gaacatggccgcaaccgggtgtatctggcggcggagctggattga

DBGET integrated database retrieval system