KEGG   Sphingobium chlorophenolicum: Sphch_2058Help
Entry
Sphch_2058        CDS       T01522                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sphch_2058
   00052 Galactose metabolism
    Sphch_2058
   00500 Starch and sucrose metabolism
    Sphch_2058
   00520 Amino sugar and nucleotide sugar metabolism
    Sphch_2058
Enzymes [BR:sch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sphch_2058
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2183679..2184578
Genome map
AA seq 299 aa AA seqDB search
MSYKAIRKAVFPVAGLGTRFLPATKSVPKELLPVVDRPLIQYAVDEAREAGIEQMIFVTG
RGKGAIEDYFDMAFEAEATQRERGKDLSALDGTRLSPGNAVFLRQQEPLGLGHAIWCARD
IVGDEPFAILLPDEFMKGKPGRGCLKQMVEAYEKVGGNLVCALEVPMAETPSYGVIDPGA
RDGALTEVKGLVEKPAPGTAPSNLILPGRYILQPEVMKILETQEKGAGGEIQLTDAMASM
IGTQPFHGVTFDGRRFDCGSKAGYIEANLALALDREDLGEHIRKFALAELGVSDIAAAA
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtcctacaaagcgattcgcaaagccgtcttccctgtcgcgggtctcggcacgcgcttc
cttccggcgaccaagtcggtgcccaaggaactgctgccggtcgtcgaccgtccgctgatc
caatatgcggtggacgaagcgcgggaagcggggatcgaacagatgatcttcgtcaccggc
cgcggcaagggcgcgatcgaggattatttcgacatggcgttcgaggctgaagccacccag
cgcgaacggggcaaggatctgtcggcgctggacggcacccgcctgtcgccgggcaacgcg
gtgttcctgcgccagcaggagccgttgggcctgggccacgccatctggtgcgcccgcgac
attgtgggcgacgaacccttcgcgatcctgctgcccgacgaattcatgaagggcaagcct
ggacgcggatgcctgaagcagatggtcgaggcttatgaaaaggtcggcggcaatctggtc
tgcgcgctggaagtgccgatggcggagacgcccagctatggcgtgatcgatccgggcgca
cgggacggcgcgctgaccgaggtgaagggactggtggaaaagcccgctcccggcacggcg
ccctcgaacctgatcctgcccggccgctacatcctccagccggaggtgatgaagatactg
gaaacgcaggaaaagggcgcaggcggggaaatccagcttaccgacgccatggcgtcaatg
atcggcacgcagcccttccacggcgtcaccttcgacggacgtcgcttcgactgcgggtcc
aaggcgggctatatcgaagcgaatctggccctggccctggaccgcgaggatctgggcgaa
catatccgcaagttcgcgctggcggaactgggcgtcagcgacatcgccgccgcggcctga

DBGET integrated database retrieval system