KEGG   Sphingobium chlorophenolicum: Sphch_2202Help
Entry
Sphch_2202        CDS       T01522                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    Sphch_2202
Enzymes [BR:sch01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     Sphch_2202
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     Sphch_2202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2357949..2358707
Genome map
AA seq 252 aa AA seqDB search
MIAIHPLFDIPEIRAGDHLAAVLRDSLTSAGLWPLKTGDVLVVTQKIMSKAEGRMVDLST
VQPGEEALELAATTRKDARLVELVLRESSAVVRAVPHVLITRHRLGHVMANGGIDRSNIG
PGEEERALLLPVDPDRSARELLDALAGPGAAGIGIVVSDSFGRPWRHGVVGVAIGAAGLP
ALVDRRGEEDRDGRRLEVTQIALADQIATAATLATGEGAESVPAALLRGLTLPPGESGAA
ALVRPLEEDLFR
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcgattcatcccctgtttgatattcccgaaatccgggccggcgaccatctggcg
gccgtgctgcgcgacagcctgacaagcgcgggcctgtggccgctgaaaaccggcgatgtg
ctggtcgtgacgcagaagatcatgtccaaggcggaagggcggatggtcgacctttccacc
gtccagccgggggaagaagcgttggaactggccgcgaccacgcgcaaggacgcccgcttg
gtggaactggtgctgcgcgaaagcagcgcggtggtgcgggcggtcccccatgtgctgatc
acccgccaccggctgggccatgtgatggcgaacggcggcatcgaccggtcgaatatcggg
ccgggggaagaagagcgcgcgctgctgctgccggtcgatccggaccggtcggcgcgggag
ttgctggatgcgctggcaggccccggcgcggccgggatcggcatcgtcgtttcggacagt
ttcggtcgcccctggcgccatggcgtggtgggcgtcgcgatcggcgcggcgggcctgccc
gcgctggtggaccgacgcggcgaagaggatcgcgacggcaggcggctggaggtgacgcag
atcgcgctggccgaccagatcgccaccgccgcgaccctggcaacgggcgagggcgcggaa
agcgtgcccgccgccctgctgcgcggcctgaccctgccccccggcgaatcgggtgcggca
gcgctggtccgtccgctggaagaggatttgttccggtga

DBGET integrated database retrieval system