KEGG   Sphingobium chlorophenolicum: Sphch_2328Help
Entry
Sphch_2328        CDS       T01522                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sch  Sphingobium chlorophenolicum
Pathway
sch00860  Porphyrin and chlorophyll metabolism
sch01100  Metabolic pathways
sch01110  Biosynthesis of secondary metabolites
sch01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sphch_2328
Enzymes [BR:sch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Sphch_2328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: AEG49989
UniProt: F6EXS5
Position
1:2492426..2493094
Genome map
AA seq 222 aa AA seqDB search
MRPLVILRPEPGAGKTAERAAELGLKARIIPLFVPRAVEWDAPAPDRFDALLLTSANAAR
LAGERLADYRTLPAYAVGRATANAMQEAGFAQVIAGDGDGTAIARRIAADGHGHVLHLAG
RTVAPVDGGALRIDRIVVYEMLRTRDDRLAERLEPDSVLLVHSPRAGEVLAQLVGPRQRA
SLHLIAISPAALAACGSGWASAQTPDKPDDERMLALALRLCE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgaggccgctcgtcatcctgcggcccgaacccggtgccggcaagacggcggaacgggcg
gcggaactggggttgaaggcgcggatcattccgttgttcgtgccgcgggcggtggaatgg
gacgcgcccgccccggatcgcttcgacgccctgttgctgaccagcgccaatgcggccagg
ctggcgggggaacggctggccgattaccggacgctgcccgcctatgcggtcggccgggcg
acggcgaatgcgatgcaggaagctggtttcgcgcaagtgattgccggggatggcgacggc
accgccattgcgcggcggatcgcggcggacgggcatggccatgtgctgcatctggccggg
cggacggtcgcgccggtcgatgggggcgcgctgcggatcgatcggatcgtcgtctatgaa
atgctgcggacacgcgacgaccggctggcggaacggctggagccggacagcgtcctgctg
gtccattccccccgcgccggggaggtgctggcgcagcttgtcggtccccggcagcgcgca
tcgctgcacctgatcgcgatcagccccgccgcgctggcggcctgcggctccggctgggcc
agcgcccagacgcccgacaagcccgatgatgagaggatgctggcccttgccctccgatta
tgcgaatga

DBGET integrated database retrieval system