KEGG   Sphingobium chlorophenolicum: Sphch_2328Help
Entry
Sphch_2328        CDS       T01522                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sch00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2492426..2493094
Genome map
AA seq 222 aa AA seqDB search
MRPLVILRPEPGAGKTAERAAELGLKARIIPLFVPRAVEWDAPAPDRFDALLLTSANAAR
LAGERLADYRTLPAYAVGRATANAMQEAGFAQVIAGDGDGTAIARRIAADGHGHVLHLAG
RTVAPVDGGALRIDRIVVYEMLRTRDDRLAERLEPDSVLLVHSPRAGEVLAQLVGPRQRA
SLHLIAISPAALAACGSGWASAQTPDKPDDERMLALALRLCE
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgaggccgctcgtcatcctgcggcccgaacccggtgccggcaagacggcggaacgggcg
gcggaactggggttgaaggcgcggatcattccgttgttcgtgccgcgggcggtggaatgg
gacgcgcccgccccggatcgcttcgacgccctgttgctgaccagcgccaatgcggccagg
ctggcgggggaacggctggccgattaccggacgctgcccgcctatgcggtcggccgggcg
acggcgaatgcgatgcaggaagctggtttcgcgcaagtgattgccggggatggcgacggc
accgccattgcgcggcggatcgcggcggacgggcatggccatgtgctgcatctggccggg
cggacggtcgcgccggtcgatgggggcgcgctgcggatcgatcggatcgtcgtctatgaa
atgctgcggacacgcgacgaccggctggcggaacggctggagccggacagcgtcctgctg
gtccattccccccgcgccggggaggtgctggcgcagcttgtcggtccccggcagcgcgca
tcgctgcacctgatcgcgatcagccccgccgcgctggcggcctgcggctccggctgggcc
agcgcccagacgcccgacaagcccgatgatgagaggatgctggcccttgccctccgatta
tgcgaatga

DBGET integrated database retrieval system