KEGG   Sphingobium chlorophenolicum: Sphch_2383Help
Entry
Sphch_2383        CDS       T01522                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sphch_2383
  Amino acid metabolism
   00340 Histidine metabolism
    Sphch_2383
Enzymes [BR:sch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Sphch_2383
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2542675..2543964
Genome map
AA seq 429 aa AA seqDB search
MTFRLSTTDSDFAAAFTALVDARREADEDVSRDVAAILKRVRAEGDAALADYTSRFDRHD
LNVSGWAVEPAECRKALESISTELRDALELAAARIAAYHEKQKPQDSDSVDAAGARLGAR
WSAVDAAGLYVPGGRAAYPSSLLMNVIPAKVAGVRRIAMVTPTPNGEINPLVLAAASIAG
IEEIWRVGGAQAVAALAYGTDRIRPVDVITGPGNAWVAEAKRQLYGVVGIDMVAGPSEIV
VVADAKNDPDWIAADLLSQSEHDPTSQSILFTDDAAFADAVAAAVDNRLPLLSTQAVATT
SWNANGAIIVVRDLEEAMPLVNRLAAEHLELAVDDPDALFAQVRHAGSVFLGRMTPEAVG
DYVAGPNHVLPTGRRARFSSGLSVLDFMKRTSFLSLDRRAIDAIGPAAVALAEAEGLPAH
AASVALRLK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaccttccgcctttccaccactgacagcgatttcgccgccgccttcaccgccctggtc
gacgcccggcgcgaagccgacgaggacgtgtcccgcgacgtcgccgcgatcctgaaacgc
gtccgcgcagagggcgacgcggcgctggccgactataccagccgtttcgaccggcacgac
ctgaacgtcagcggctgggcggtggagcctgccgaatgccgcaaggcgctggaaagcatt
tccaccgaattgcgcgacgcgctggaactcgcggcggcgcggatcgcggcctatcatgaa
aaacagaagccgcaggacagcgacagcgtcgacgcggcgggcgcgcgtctgggcgcgcgc
tggagcgcggtggacgcggcggggctgtacgttcccggcggacgcgccgcctatcccagt
tcgctgctgatgaacgtgatccccgccaaggtcgcgggcgtccggcgcatcgccatggtc
acgccgacccccaatggagagatcaacccgctggtcctcgcggcggcctccatcgccggg
atagaggaaatctggcgcgtcggcggggcgcaggcggtggccgcgctcgcctatggcacg
gaccggatcagaccggtcgacgtcatcaccggccccggcaacgcctgggtggcggaggcg
aagcgccagctttacggcgtggtcggcatcgacatggtggccggtccgtccgagatcgtc
gtggtggccgatgcgaagaatgatcccgactggattgccgccgacctgctcagccagtcg
gaacatgacccgaccagccagtcgatcctcttcaccgacgatgcggcctttgccgacgcg
gttgctgcggcggtggataatcgcctgccgctgctgtcgacgcaggctgtggcgacgacg
agctggaacgcgaacggcgcgatcatcgtcgtgcgcgacctggaagaagccatgccgctg
gtcaaccgcctcgccgccgagcatctggaactggccgtggacgatcccgacgccctgttc
gcgcaggttcgccatgccgggtcggtcttcctgggccgcatgacgccggaggcggtgggc
gattatgtcgccgggccgaaccatgtgctgccgaccggccgccgggcgcgcttctcttcg
ggcctgtcggtgctggacttcatgaagcgcaccagcttcctcagcctcgaccggcgcgcc
atcgacgccatcggccccgccgccgtcgcgctggcggaggcggaggggcttcccgcccat
gcggcttcggtcgccttgagattgaaatga

DBGET integrated database retrieval system