KEGG   Sphingobium chlorophenolicum: Sphch_2463Help
Entry
Sphch_2463        CDS       T01522                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sphch_2463
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sphch_2463
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sphch_2463
Enzymes [BR:sch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sphch_2463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2615341..2616741
Genome map
AA seq 466 aa AA seqDB search
MQYVSTRGSAPALGFEDVTLAGLASDGGLYLPESWPSFSADQIRALSGLSYVETAVRVMT
PFVAGSLSEEELRALCAAAYGRFSHDAVTPLVQLDHRHWLLELFHGPTLAFKDVALQLLG
QLFERFLSRRDDHLTIVGATSGDTGSAAIDAVAGREKIDIFMLHPEGRVSDVQRRQMTTV
LAPNVYNIAIGGSFDDAQALVKAMFNDAAFARRFNLSAVNSINWARLMAQVVYYFYAAVR
LGAPDRAIAFSVPTGNFGDVFAGYVAAKMGLPVAKLMVATNVNDILHRALADGDYSQGQV
VATATPSMDIQVSSNFERLLFDAGGRDGKALAEQMKGFEASKAMRLTNAQREGASALFTS
ARVDADAMTMAMRWAYDAAGQVIDPHSAIGLAAARSIDLDPAVPVVTLATAHAAKFPTAV
ERATGIRPSLPSRVGDLFAREEAYAKLPGTFEAVTAYVAERATPRA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcaatatgtgagcaccagggggagcgcgcccgcgctcgggttcgaggatgtgacgctg
gctgggctggcgtccgatggcggcctctatctgccggaaagctggcccagcttttccgct
gaccaaattcgcgcgctgtccggcctctcctatgtcgaaacggcggtgcgggtcatgacg
cccttcgtcgccgggtcgctcagcgaagaggaattgcgcgcattgtgcgccgccgcctat
ggccggttcagccatgacgcggtgacgccgctggtgcaactcgaccatcgccactggctg
ctggaactgttccacgggccgacgctggcgttcaaggatgtggcgctgcaactgctcggc
cagttgttcgaacgcttcctgtcgcggcgggacgaccatctcaccatcgtcggcgcgaca
tcgggcgacaccggttcggcggcgatcgacgcggtggcgggacgcgagaagatcgatatc
ttcatgctgcatcccgaagggcgcgtgtccgacgtgcagcgccgccagatgaccacggtg
ctggcgcccaatgtctataatatcgccatcggcggcagcttcgacgacgcgcaggcgctg
gtgaaggcgatgttcaatgacgcggccttcgcccgccgcttcaacctgtcggcggtgaac
agcatcaactgggcacggctgatggcgcaggtcgtctattatttctacgccgccgtgcgc
ctaggcgcgccggacagggccatcgccttttccgttcccaccggcaatttcggcgacgtg
ttcgcgggctatgtcgcggcgaagatgggcctgcccgtcgcgaagctgatggtcgcgacc
aacgtgaacgacatcctccaccgcgccctggccgacggcgattacagccaggggcaggtg
gtcgcgactgcgacccccagcatggacatccaggtcagctccaacttcgaacgactgctg
ttcgacgcgggtggccgtgatggcaaggcgctggcggaacagatgaagggctttgaagcc
agcaaggcgatgcgcctcaccaacgctcagcgggagggggcatcggcgctcttcacctcg
gcgcgggtcgatgccgacgccatgaccatggcgatgcgctgggcctatgacgcggccggg
caggtgatcgatccgcatagcgccatcggcctggcggcggcgcgctcgatcgatctcgac
ccggcggtgcccgtggtcacgctggcgacggcccatgcggcgaaattccccacggcggtc
gagcgggccaccggcatccgcccctcgctgccttcgcgggtgggcgacctgttcgcgcgg
gaagaggcctatgccaagctgcccggcaccttcgaagcggtcactgcctatgtcgcggag
cgggcgacgccgagggcctga

DBGET integrated database retrieval system