KEGG   Sphingobium chlorophenolicum: Sphch_2843Help
Entry
Sphch_2843        CDS       T01522                                 

Definition
(GenBank) Isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sch  Sphingobium chlorophenolicum
Pathway
sch00630  Glyoxylate and dicarboxylate metabolism
sch01100  Metabolic pathways
sch01110  Biosynthesis of secondary metabolites
sch01120  Microbial metabolism in diverse environments
sch01200  Carbon metabolism
Module
sch_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sphch_2843
Enzymes [BR:sch01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Sphch_2843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase Lipase_GDSL_2
Motif
Other DBs
NCBI-ProteinID: AEG50476
UniProt: F6ETA2
Position
1:3016125..3017717
Genome map
AA seq 530 aa AA seqDB search
MTYSQEITKAGTTIGGQGHWDGIAAESVARMRLQNRFHTGLDIARYTAGIMRRDMAAYDA
DPANYTQSLGCWHGFIGQQKMISIKKHFGTTKGRYLYLSGWMVAALRSKFGPLPDQSMHE
KTSVPALIEELYTFLKQADARELGMMFRDLDAAREAGDEVKAQKIQHDIDTYETHVVPIV
ADIDAGFGNAEATYLLAKKFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRA
VRYAFLELGVDDGIIVARTDSLGAGLTKQIAYSKEEGDLGDQYNSFLDVEEVTDLGSLRG
DVVLARDGKLFRPKRLPSNLFQFRAGTGEDRCVLDCITSLQNGADLLWIETEKPHIQQIA
GMVDRIREVVPNAKLVYNNSPSFNWTLNFRQQVFDAWVAEGKDVSAYDRAKLMSADYDAT
DLGLEADEKIRTFQKDAAARAGIFHHLITLPTYHTAALSTDNLAKEYFGEAGMLGYVAGV
QRKEIRQGIACVKHQNMSGSDIGDDHKEYFAGEAALKAGGIHNTMNQFAA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgacctacagccaggaaatcacgaaagcgggcaccaccatcggcggacagggccattgg
gacggcatcgcggccgaatcggtcgctcgcatgcgcctccagaaccgcttccacaccggc
ctcgacatcgcccgctacaccgccggcatcatgcgccgcgacatggccgcctatgacgcc
gacccggccaactacacccagtcgctgggctgctggcacggcttcatcggccagcagaag
atgatcagcatcaaaaagcatttcggcaccaccaagggccgttatctctacctgtccggc
tggatggtcgccgccctgcgcagcaaattcggtccgctgcccgaccagtcgatgcatgaa
aagaccagcgtcccggcgctgatcgaggaactctacaccttcctgaagcaggccgacgcc
cgcgaactgggcatgatgttccgcgacctcgacgccgcccgcgaagccggcgacgaagtc
aaggcgcagaagatccagcacgacatcgacacctacgaaacccatgtcgtccccatcgtc
gcggacatcgacgcaggcttcggcaatgccgaggcgacctatctgctcgccaagaagttc
atcgaggcgggcgcctgctgcatccagatcgaaaaccaggtctcggacgaaaagcagtgc
ggccaccaggacggcaaggtcaccgtgccgcatgaggatttcctcgcgaagatccgcgct
gtccgctacgccttcctggaactgggcgtcgacgacggcatcatcgtcgctcgcaccgac
tcgctgggcgccggcctgaccaagcagatcgcctacagcaaggaagagggcgacctgggc
gaccagtataacagcttcctcgatgtcgaggaggtcacggacttgggcagcctgcgcggc
gatgtcgtcctggcccgcgacggcaagctgttccgtcccaagcgcctgccgtcgaacctg
ttccagttccgcgccggaaccggcgaagaccgctgcgtcctcgactgcatcacctcgctc
cagaacggcgcggacctgctgtggatcgaaactgaaaagccgcacatccagcagatcgcg
ggcatggtcgaccgcatccgcgaagtcgtcccgaatgcgaagctggtctacaacaactcg
ccgtcgttcaactggacgctgaacttccgccagcaggtgttcgacgcctgggtcgccgag
ggcaaggacgtcagcgcctatgaccgggcgaagctgatgagcgccgattatgacgcgacc
gatctgggccttgaggctgacgagaagatccgcaccttccagaaggatgcggcggcgcgg
gccggcatcttccatcacctcatcaccctgccgacctaccacacggccgccctgtcgacc
gacaacctcgccaaggaatatttcggcgaggcgggcatgctgggctatgtcgcgggcgtc
cagcgcaaggaaatccgccagggcatcgcctgcgtcaagcaccagaacatgtccggttcg
gacattggcgacgaccataaggaatatttcgcgggtgaagcggcgctgaaggcgggcggc
atccacaataccatgaaccagtttgcggcctaa

DBGET integrated database retrieval system