KEGG   Sphingobium chlorophenolicum: Sphch_2878Help
Entry
Sphch_2878        CDS       T01522                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Sphch_2878
Enzymes [BR:sch01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Sphch_2878
Exosome [BR:sch04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sphch_2878
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3043611..3045092
Genome map
AA seq 493 aa AA seqDB search
MSEPRILVLDEGTTSTRAMLYAPDGRRLGMAQAELAQHYPQPGWVEHDAAEIWEKSLACA
RDMVALAGGADHVAAIGITNQRETVVAWDRRTGEPLAPAIVWQDRRTADHCAALRQAGEE
DAIQRRTGLVLDPYFSATKMRWLLDHAPAVAAAGDALAFGTVESWLVWKLTGGLHVSDAS
NASRTQLMALDGTEWDRGLCDLFGVPPRALPEICDNIGAFGETRAEWFGRPIAIRGLMGD
QQAATIGQGCLTPGDAKATLGTGAFVLANMGSNVPVSRHRLLGTLLCRLPGETSYALEGS
LFVAGSLIQWLRDELGLIATAEETEALARSMPDSGGVTMLPALAGLGAPHWRAEAKGMIH
GLTLGTKRAHIVRAALESLSHQLHDLSGAFAADGVPWRVLRVDGGMSANDWIAQDLADIL
NLPVDRPADVETTAKGAAMLAAVGGGLFPSLREAASAMGAGTRRFAPALPGDRRAARLEG
WRTLLAVSAFSPV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccgcgcatattggtgctggacgagggcacgacgtcgacccgggcgatgctc
tatgcgccggacgggcggcggttgggcatggcgcaggcggaacttgcgcaacattatccg
cagcccggctgggtcgaacatgacgcggcggagatttgggagaagagcctggcttgcgcc
cgcgacatggtggcgctggcgggcggggcggatcatgtcgccgccatcggcatcaccaac
cagcgcgaaaccgtggtggcgtgggaccggcggacgggcgagccgctggcccccgccatc
gtctggcaggaccgccgcaccgccgatcattgcgccgcgctgcggcaggcgggcgaggag
gatgcgattcagcggcggaccgggctggtgctcgacccttatttttccgcgaccaagatg
cgctggctgctggaccatgcaccggccgtcgcggcggcgggggatgcgctggccttcggc
acggtcgaaagctggctggtgtggaagctgaccggcggcctgcatgtcagcgacgccagc
aatgccagccgcacccagttgatggcgcttgacgggacggaatgggaccggggcctctgc
gatctgttcggcgttccgccgcgcgccttgccggagatttgcgacaatatcggcgccttt
ggcgagacgcgggcggaatggttcggccggcccattgcgatccggggcctgatgggcgac
cagcaggcggcgaccatcggccagggttgcctgacgcccggcgatgccaaggcgacgttg
ggcaccggcgccttcgtcctcgccaacatgggcagcaatgtgccggtgtcgcggcaccgc
ctgctgggaaccttgctctgccgcctgccgggcgagaccagctatgcgctggaggggtcg
ctgttcgtcgcgggcagcctgatccaatggctgcgcgacgaactgggcttgatcgccacg
gcggaggagacggaggcgctggcgcgttccatgccggacagcggtggcgtcaccatgctg
cccgcgctggcggggctgggcgcgccgcattggcgggcggaggcgaagggcatgatccat
ggcctgacgctgggcacgaagcgcgcgcatatcgtgcgcgccgcgctcgaatcgctgtcg
caccagcttcatgatctgtccggcgctttcgcggctgacggggtgccgtggcgcgtcctg
agggtggatggcggcatgagcgccaatgactggatcgcccaggatctggccgacattctg
aacctgcctgtcgaccgtcccgccgatgtggagaccaccgccaagggagcggccatgctg
gccgcggtgggcggcggcctgttcccctcgctccgggaggcggcatcggcaatgggggcg
gggacgcggcggttcgcgccggccttgcccggcgatcggcgggcggcaaggctggaagga
tggcggacgctgctggcggtctccgcattttctcctgtgtag

DBGET integrated database retrieval system