KEGG   Sphingobium chlorophenolicum: Sphch_2878Help
Entry
Sphch_2878        CDS       T01522                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sch00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3043611..3045092
Genome map
AA seq 493 aa AA seqDB search
MSEPRILVLDEGTTSTRAMLYAPDGRRLGMAQAELAQHYPQPGWVEHDAAEIWEKSLACA
RDMVALAGGADHVAAIGITNQRETVVAWDRRTGEPLAPAIVWQDRRTADHCAALRQAGEE
DAIQRRTGLVLDPYFSATKMRWLLDHAPAVAAAGDALAFGTVESWLVWKLTGGLHVSDAS
NASRTQLMALDGTEWDRGLCDLFGVPPRALPEICDNIGAFGETRAEWFGRPIAIRGLMGD
QQAATIGQGCLTPGDAKATLGTGAFVLANMGSNVPVSRHRLLGTLLCRLPGETSYALEGS
LFVAGSLIQWLRDELGLIATAEETEALARSMPDSGGVTMLPALAGLGAPHWRAEAKGMIH
GLTLGTKRAHIVRAALESLSHQLHDLSGAFAADGVPWRVLRVDGGMSANDWIAQDLADIL
NLPVDRPADVETTAKGAAMLAAVGGGLFPSLREAASAMGAGTRRFAPALPGDRRAARLEG
WRTLLAVSAFSPV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagccgcgcatattggtgctggacgagggcacgacgtcgacccgggcgatgctc
tatgcgccggacgggcggcggttgggcatggcgcaggcggaacttgcgcaacattatccg
cagcccggctgggtcgaacatgacgcggcggagatttgggagaagagcctggcttgcgcc
cgcgacatggtggcgctggcgggcggggcggatcatgtcgccgccatcggcatcaccaac
cagcgcgaaaccgtggtggcgtgggaccggcggacgggcgagccgctggcccccgccatc
gtctggcaggaccgccgcaccgccgatcattgcgccgcgctgcggcaggcgggcgaggag
gatgcgattcagcggcggaccgggctggtgctcgacccttatttttccgcgaccaagatg
cgctggctgctggaccatgcaccggccgtcgcggcggcgggggatgcgctggccttcggc
acggtcgaaagctggctggtgtggaagctgaccggcggcctgcatgtcagcgacgccagc
aatgccagccgcacccagttgatggcgcttgacgggacggaatgggaccggggcctctgc
gatctgttcggcgttccgccgcgcgccttgccggagatttgcgacaatatcggcgccttt
ggcgagacgcgggcggaatggttcggccggcccattgcgatccggggcctgatgggcgac
cagcaggcggcgaccatcggccagggttgcctgacgcccggcgatgccaaggcgacgttg
ggcaccggcgccttcgtcctcgccaacatgggcagcaatgtgccggtgtcgcggcaccgc
ctgctgggaaccttgctctgccgcctgccgggcgagaccagctatgcgctggaggggtcg
ctgttcgtcgcgggcagcctgatccaatggctgcgcgacgaactgggcttgatcgccacg
gcggaggagacggaggcgctggcgcgttccatgccggacagcggtggcgtcaccatgctg
cccgcgctggcggggctgggcgcgccgcattggcgggcggaggcgaagggcatgatccat
ggcctgacgctgggcacgaagcgcgcgcatatcgtgcgcgccgcgctcgaatcgctgtcg
caccagcttcatgatctgtccggcgctttcgcggctgacggggtgccgtggcgcgtcctg
agggtggatggcggcatgagcgccaatgactggatcgcccaggatctggccgacattctg
aacctgcctgtcgaccgtcccgccgatgtggagaccaccgccaagggagcggccatgctg
gccgcggtgggcggcggcctgttcccctcgctccgggaggcggcatcggcaatgggggcg
gggacgcggcggttcgcgccggccttgcccggcgatcggcgggcggcaaggctggaagga
tggcggacgctgctggcggtctccgcattttctcctgtgtag

DBGET integrated database retrieval system