KEGG   Sphingobium chlorophenolicum: Sphch_3100Help
Entry
Sphch_3100        CDS       T01522                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sphch_3100
   00500 Starch and sucrose metabolism
    Sphch_3100
Enzymes [BR:sch01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Sphch_3100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:217440..218612
Genome map
AA seq 390 aa AA seqDB search
MVPGTFRAFSARGAERPGSPAARTAWSGLLLFAALAAPAVATGATPVYEVSAHCDGKARC
YPSIGQAIAASEQVGGGWVDIRVGPGDYREKLIISRAKTRLTGSGVAKTRLHFDAVAQHA
RAWHRDGWGTPGSATLTIRADRVTVSGLTVENRFDYLANDARPEGDPARIADAQAVALLL
DVGSDRVLLRHVALLGYQDTLFANGRRALIRDSLIAGNIDFIFGNGMLWIDRSELRSRPR
ARPPAPGGFQSYIAAPSTPRSQAMGIVVTRSRLTREAGVPDGAVALARPWHPTTRFADGR
YADPDAVGQAVFIDCFMDAHIHPDHWTGMAGTARNGSKSAFFRPQDARFFKRGSHGPGAP
HRDIGMRWSPPQSTDSMWKQFAADWPDIGK
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atggttcccgggacgtttcgcgctttttctgcacgcggtgcggaacgccccggctccccc
gcagcccggaccgcatggtccgggctgctccttttcgcggcgctggcggcacccgccgtc
gccacgggcgccacgccggtctatgaggtcagcgcccactgcgacggcaaggcgcgctgc
tatccctccatcggccaggcgatcgccgcatccgaacaggtgggcggcggctgggtcgac
atccgggtcgggccgggcgactatcgggaaaagctgatcattagccgtgcgaagacgcgg
ctgaccggatcgggggtggccaagacccggctgcatttcgacgcggtggcgcagcatgcg
cgcgcatggcatcgcgacggatggggcacgcccggatcggcgacgctgaccatccgggcc
gaccgcgtcacggtgagtggcctgaccgtggaaaaccggttcgattatctggccaatgat
gcgcgacctgagggtgatcccgcccggatcgccgatgcgcaggcggtcgcgctgttgctg
gatgtcggcagcgaccgggtgctgctgcgccatgtcgcgctgctgggctatcaggacaca
ttattcgccaacggacggcgggcgttgatccgcgacagcctgatcgcgggcaatatcgac
ttcatcttcggcaacggcatgttgtggatcgaccgcagcgaattgcggtcccggccccgc
gcccggccgcccgcgcccggcggcttccaatcctatatcgccgcgccctccacgccccgg
tcgcaggcgatgggcatcgtagtaacccgctcccgcctgacgcgggaagcgggcgtgccc
gacggcgcggtggcgctcgcccgtccctggcacccgaccacccgcttcgccgacggccgc
tatgccgatccggacgcggtcggccaggcggtgttcatcgactgtttcatggacgcacac
atccatcccgaccactggaccggcatggccgggaccgcccgcaacggcagcaagagcgcc
tttttccgtccgcaggatgcgcgtttcttcaaacgcggctcccacggccccggcgcaccg
catcgcgacatcggcatgcgatggtcgccgccgcaatcgacggacagcatgtggaaacaa
ttcgccgctgactggccggacatcggaaaataa

DBGET integrated database retrieval system