KEGG   Sphingobium chlorophenolicum: Sphch_3241Help
Entry
Sphch_3241        CDS       T01522                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sch  Sphingobium chlorophenolicum
Pathway
sch00071  Fatty acid degradation
sch00280  Valine, leucine and isoleucine degradation
sch00281  Geraniol degradation
sch00310  Lysine degradation
sch00360  Phenylalanine metabolism
sch00362  Benzoate degradation
sch00380  Tryptophan metabolism
sch00410  beta-Alanine metabolism
sch00627  Aminobenzoate degradation
sch00640  Propanoate metabolism
sch00650  Butanoate metabolism
sch00903  Limonene and pinene degradation
sch00930  Caprolactam degradation
sch01100  Metabolic pathways
sch01110  Biosynthesis of secondary metabolites
sch01120  Microbial metabolism in diverse environments
sch01130  Biosynthesis of antibiotics
sch01212  Fatty acid metabolism
Module
sch_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Sphch_3241
   00650 Butanoate metabolism
    Sphch_3241
  Lipid metabolism
   00071 Fatty acid degradation
    Sphch_3241
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Sphch_3241
   00310 Lysine degradation
    Sphch_3241
   00360 Phenylalanine metabolism
    Sphch_3241
   00380 Tryptophan metabolism
    Sphch_3241
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sphch_3241
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Sphch_3241
   00281 Geraniol degradation
    Sphch_3241
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Sphch_3241
   00627 Aminobenzoate degradation
    Sphch_3241
   00930 Caprolactam degradation
    Sphch_3241
Enzymes [BR:sch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Sphch_3241
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Motif
Other DBs
NCBI-ProteinID: AEG50851
UniProt: F6F339
Position
2:375038..375799
Genome map
AA seq 253 aa AA seqDB search
MSEVEFLVQDNVAIVTINRPGARNAINLNVAQEIEAALERIESDPDIRVGIVTGAGGNFC
AGMDLKGFLKGERPRTAKGGFAGITKAKLKKPMIAAIEGYALAGGFEIALACDLIVVGEG
AKVGVPEVKRGLVANAGGLLRLPRQLPERIAAEMVLTGDLYSVRDLAVYGLFNRVVPDGQ
ALAEAQALAGKIAANGPLALAASKHVLRASRLWAEDEMFAQQDAITLPVFDSADAREGAA
AFAEKRAPVWRGA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagtggaatttttggtccaggacaacgttgcgatcgtcacgatcaatcggccg
ggcgcacgcaatgcgatcaatctgaatgtcgcgcaggaaatcgaagcggcgctcgagcgg
atcgaaagcgatccggacatccgcgtcggtatcgttacgggcgctggcggcaacttttgc
gccggcatggatctgaagggatttctgaaaggcgagcggccccgcacggcgaagggcggc
tttgccgggatcaccaaagccaagctcaagaaaccaatgatcgccgccatcgaaggctat
gccttggccggcggcttcgagatcgcgctcgcttgcgatcttatcgtggtgggggagggc
gcgaaggtcggcgtgcctgaggtcaagcgcggcctggtcgccaatgcgggcggactgctg
cgactgccgcgacaattgcccgaacggattgccgcggaaatggtcctcaccggcgatctc
tattccgtgcgcgacctggcggtgtatggcttgttcaatcgcgtcgtacctgacgggcaa
gcgctggccgaggcgcaagcccttgcgggcaagatcgcggcgaacggcccgctggctctg
gcggcgagcaaacatgtacttcgcgcttcgcgtctgtgggccgaagatgagatgttcgcc
cagcaggacgccatcacgctgcccgtgttcgattccgccgatgcgcgggaaggggctgcc
gccttcgccgagaagcgcgcgccggtctggcgcggggcatga

DBGET integrated database retrieval system