KEGG   Sphingobium chlorophenolicum: Sphch_3345Help
Entry
Sphch_3345        CDS       T01522                                 

Definition
limonene-12-epoxide hydrolase
Orthology
K10533  
limonene-1,2-epoxide hydrolase [EC:3.3.2.8]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Limonene and pinene degradation
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:sch00903]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:493558..493959
Genome map
AA seq 133 aa AA seqDB search
MTKPLTPAETVRSFIQCFNQNRLEDALEYLAEDVFYHNIPLEPIVGREATRAFMAEFDLG
NSLRAEWEILALATDGETVLTERIDKFYRAGGPREGIPLMGSFRVQDGKITVWRDYFDLT
AFQNMVVLHTPRT
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
gtgacaaagccgcttacccctgccgagacggttagatcctttattcagtgcttcaaccaa
aatcggttggaggacgccctcgaatatctcgccgaggacgttttttatcacaatatcccg
ctcgaacccatcgtcgggcgcgaggcaactcgggcgttcatggccgagtttgatctggga
aactcgctgcgggccgaatgggaaatcctcgcgcttgccaccgacggtgagaccgtgctg
accgagcggattgacaagttctatcgggcaggtgggccgcgcgagggtattcccctcatg
gggagctttcgtgtccaagacggaaagattaccgtctggcgtgattatttcgatctaaca
gctttccagaatatggtggtattgcatacgccacgaacctga

DBGET integrated database retrieval system