KEGG   Sphingobium chlorophenolicum: Sphch_3478Help
Entry
Sphch_3478        CDS       T01522                                 

Definition
hypothetical protein
Organism
sch  Sphingobium chlorophenolicum
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(663240..663716)
Genome map
AA seq 158 aa AA seqDB search
MTIDLLAARFEIEQLIYRYGHVLDAGGGEPFADLFVEDGEIQLRSLYADRTDVDAGIPWK
EQGLSAGAELQGDRLVFRGRQKLHHFSLPKGNPAIQFHVVSQPLVTILTPTTAAAQSYMR
VYATPHGQPPQLKVVGKYSDQFIRNNDQWKFKTRTCEI
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgaccatcgacctcctggccgcgcggttcgagatcgaacagctcatctatcgctacggc
catgtcctcgacgcaggcggcggcgaacccttcgccgacctgttcgtcgaggatggcgaa
atccagttgcgcagcctctatgccgaccgaaccgatgtcgacgccggcatcccctggaag
gaacagggcctgagcgcaggcgccgaacttcagggcgacaggctggtgttcaggggacgg
caaaaactccaccacttctccctccccaagggaaacccagccatccagttccatgtcgtc
agccagccactcgtcacaatcctcacccccaccaccgctgcggcccaaagctatatgcgc
gtttatgcaacaccccatggccaaccgccacagctcaaggtcgtcggaaaatactccgat
cagttcattcgcaacaacgatcagtggaagtttaaaaccagaacatgcgagatctga

DBGET integrated database retrieval system