KEGG   Sphingobium chlorophenolicum: Sphch_3763Help
Entry
Sphch_3763        CDS       T01522                                 

Definition
precorrin-2 C(20)-methyltransferase (EC:2.1.1.130)
Orthology
K03394  
precorrin-2/cobalt-factor-2 C20-methyltransferase [EC:2.1.1.130 2.1.1.151]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Sphch_3763
Enzymes [BR:sch01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.130  precorrin-2 C20-methyltransferase
     Sphch_3763
    2.1.1.151  cobalt-factor II C20-methyltransferase
     Sphch_3763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(976529..977248)
Genome map
AA seq 239 aa AA seqDB search
MTQGTIHGVGLGPGAQDLMSVRADRLIREARHIAFFRKRGKPGQARRIVEGMLRPDIIEF
PMEYPVTTEIPLVDPRYNDLLSAFYADCTAHLDGLSASGEDVVVLCEGDPFFYGSFMHLH
SRLAAPVRIVPGITGMSGAWTASGTPISWGDDVLTVLMATLSEEELARRIHDTNALVVMK
IGRNLPKLRRAVEAAGKQDCAWLVEYATMADQRITPLAEATDVTAYFSILLVHGQGRRP
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgacccaaggcaccatccacggcgtaggcctgggtcccggcgcgcaggatttgatgagc
gtccgcgccgaccgcctgatccgcgaagcccgccacatcgcctttttccgcaagagggga
aagccgggtcaggcccgccggatcgtggagggcatgctgcggcccgacatcatcgaattt
cccatggaatatccggtgaccacggaaatcccgctggtcgatccgcgctacaatgatctt
ctgtcggccttctacgccgattgcaccgctcatctggacgggctttccgccagcggcgag
gatgttgtggtcctctgcgaaggcgatccctttttctacggcagcttcatgcacctgcac
agccgcctcgccgccccggtcaggatcgttcccggcatcaccggcatgtccggcgcctgg
accgccagcggaacgccgatcagttggggtgacgacgtcctgacggtgctgatggcgacc
ctgtccgaagaggaactggcccgccgcatccacgacaccaatgcgctggtcgtgatgaag
atcggccgcaacctcccgaagctgcgccgcgccgtcgaggcggcgggaaagcaggactgc
gcctggctggtcgaatatgcgaccatggccgatcagcgcatcacgccattggccgaagcg
accgacgtcaccgcctatttctctatcctgctggtccatgggcagggccgtcgtccatga

DBGET integrated database retrieval system