KEGG   Sphingobium chlorophenolicum: Sphch_3954Help
Entry
Sphch_3954        CDS       T01522                                 

Definition
acireductone dioxygenase (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:sch00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:complement(1226908..1227462)
Genome map
AA seq 184 aa AA seqDB search
MTRLSRYDDKAPFAERGTLDDFNAIVAAMAEAGVTLERWEAGATLPADARDGDILAAYAS
DIDRLNRRGGYKSCDVMRLAPDHPDRAALRGKFLAEHVHDDDEVRFFVEGGGLFYIRANG
AVHALECTAGDLILLPAGTTHWFDMGEHPRFTAIRLFVTPEGWVARFTGDPIAESIPLYD
GAAA
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggctctcccgatatgacgacaaggctcccttcgccgagcgcggaaccctcgac
gatttcaacgccatcgtcgcggcgatggcggaggctggcgtgacgctggaacgttgggag
gccggggccacgctgcccgccgatgcgcgggacggcgacatattggcggcctatgcgtcc
gacattgaccggctcaatcggcgcggcggctataaaagctgcgacgtgatgcgcctggcc
ccggatcatccggatcgcgccgccttgcgcggcaaattcctggccgaacatgtccatgac
gatgacgaggtgcgcttctttgtcgaaggcggcggcctcttttacatccgcgccaatggg
gcggtccatgcgctggaatgtacggcgggcgacctcatcctgcttcccgcgggcacgacc
cactggttcgacatgggcgaacatccgcgtttcaccgccattcgcctgttcgtcacgccc
gaagggtgggtcgcccgcttcaccggcgatcccatcgcggaatcgatccccctctatgac
ggcgccgccgcatga

DBGET integrated database retrieval system