KEGG   Sphingobium chlorophenolicum: Sphch_4174Help
Entry
Sphch_4174        CDS       T01522                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sch00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pSPHCH01:98902..100440
Genome map
AA seq 512 aa AA seqDB search
MKPGIIEDAEAEPVATTLRARRIGLSAAGSDLIAVMRHDCPVCRSEGLASRAQVALRAGG
REIVVSLLHSSAETPAPGEIGLSESAWQRLGVSDGDPVEIAHAQPLASLAEVRRRIYGNR
LSDGAFSAIITDIAERRYSDVHLSAFVTACSAVPLDTDETISLTRAMVDVGERLQWPGTV
IVDKHGVGGLPGNRTTPIIVSIMAAEGLIMPKTSSRAITSPAGTADTMEVLAPVDLDVSA
IRKVVEREGGCIAWGGAVNLSPADDVIIGVERVLDIDAVGQMVASVLSKKIAAGATHLVI
DIPVGPTAKVRGADAADTLERALSSVAQAFGLRTRVMRGPGAEPIGRGIGPALEAQDILA
VLQGQPGAEDLAHRACELAGGLLELADAAPAREGYARARACLESGRAWAKFQRICEAQGG
MRAPPVARFQQDMIAPYSGRLVSIDNRKLATVAKLAGAPMAKAAGVALQCRLNQMVDAGA
PLCSIHAESPGELDYAAAYAVSDGPIFGIEAL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcccgggatcatcgaggacgccgaagcagagcctgtcgcgacgacgctgcgggca
cgccgcatcggcctgtcggctgccggaagcgatctgatcgcggtcatgcgccacgactgt
cccgtctgccgctcggaaggtcttgcgtcccgcgcgcaggtcgcgctgcgcgccggcggg
cgggaaatcgtcgtctcgctgctgcacagctccgcggagactccagcgcccggcgagatc
ggcctctccgaatccgcatggcagcggctcggcgtcagcgatggcgatccggtcgagatc
gcgcacgcccagcctctcgcctcgctcgccgaagtgcgtcggcgcatctatggcaatcgt
ctcagtgacggggctttttcagcgatcatcaccgacatcgccgagcgacgctatagcgat
gtccatctctcggcgttcgtcacggcctgctcagcggtcccgctcgatacggacgaaacg
atcagcctgaccagggcgatggtcgatgtcggcgagcgattgcagtggcccggaacggtc
atcgtcgacaagcatggcgtcggtggcttgccgggcaatcgcaccacgccgatcatcgtc
tcgatcatggccgcggagggcctgatcatgcccaagacatcgtcgcgggcgatcacctca
ccggccggcacggcggacacgatggaggtgctggcacctgtcgacctcgacgtttccgca
atccgcaaggtggtcgagcgcgaaggcggctgcatcgcctggggcggcgccgtcaacctc
agccctgccgacgatgtgatcatcggcgtggaacgggtgctcgatatcgatgccgtcggg
cagatggtcgcctcggtgctgtccaagaaaatcgcggccggtgcgacccatctggtcatc
gacatcccggtcgggccgaccgccaaggtacgcggcgccgatgccgccgacacgctcgag
cgggcgctgagctctgtcgcccaagccttcgggcttcgcacgcgcgtgatgcgcggcccc
ggcgccgagccgatcggacggggcatcggtccggcgctcgaggcgcaggatatccttgcc
gtgctccaggggcagccgggcgccgaggatctcgcccaccgggcctgcgagctggcggga
ggactgcttgagctcgcggacgcagccccggcccgcgaaggttatgcgcgtgcgcgggcg
tgcctcgaaagcggccgggcctgggccaagttccaacgtatctgcgaagcgcagggcggc
atgcgggctccaccggtcgcccggttccaacaggatatgatcgctccctatagcggccgc
ctggtgagtatcgacaatcgcaagctcgcgacggtcgcgaagcttgccggcgcgccgatg
gccaaggccgccggcgtcgcgctgcagtgtcggctgaaccagatggtggatgccggggct
cccttgtgtagcattcatgccgagagcccgggcgagctcgactatgcggcggcctatgcg
gtgagcgacgggccgatcttcgggattgaagcgctatga

DBGET integrated database retrieval system