KEGG   Sphingobium chlorophenolicum: Sphch_4174Help
Entry
Sphch_4174        CDS       T01522                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
sch  Sphingobium chlorophenolicum
Pathway
sch00240  Pyrimidine metabolism
sch01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sphch_4174
Enzymes [BR:sch01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Sphch_4174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: AEG51752
UniProt: F6F493
Position
pSPHCH01:98902..100440
Genome map
AA seq 512 aa AA seqDB search
MKPGIIEDAEAEPVATTLRARRIGLSAAGSDLIAVMRHDCPVCRSEGLASRAQVALRAGG
REIVVSLLHSSAETPAPGEIGLSESAWQRLGVSDGDPVEIAHAQPLASLAEVRRRIYGNR
LSDGAFSAIITDIAERRYSDVHLSAFVTACSAVPLDTDETISLTRAMVDVGERLQWPGTV
IVDKHGVGGLPGNRTTPIIVSIMAAEGLIMPKTSSRAITSPAGTADTMEVLAPVDLDVSA
IRKVVEREGGCIAWGGAVNLSPADDVIIGVERVLDIDAVGQMVASVLSKKIAAGATHLVI
DIPVGPTAKVRGADAADTLERALSSVAQAFGLRTRVMRGPGAEPIGRGIGPALEAQDILA
VLQGQPGAEDLAHRACELAGGLLELADAAPAREGYARARACLESGRAWAKFQRICEAQGG
MRAPPVARFQQDMIAPYSGRLVSIDNRKLATVAKLAGAPMAKAAGVALQCRLNQMVDAGA
PLCSIHAESPGELDYAAAYAVSDGPIFGIEAL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
gtgaagcccgggatcatcgaggacgccgaagcagagcctgtcgcgacgacgctgcgggca
cgccgcatcggcctgtcggctgccggaagcgatctgatcgcggtcatgcgccacgactgt
cccgtctgccgctcggaaggtcttgcgtcccgcgcgcaggtcgcgctgcgcgccggcggg
cgggaaatcgtcgtctcgctgctgcacagctccgcggagactccagcgcccggcgagatc
ggcctctccgaatccgcatggcagcggctcggcgtcagcgatggcgatccggtcgagatc
gcgcacgcccagcctctcgcctcgctcgccgaagtgcgtcggcgcatctatggcaatcgt
ctcagtgacggggctttttcagcgatcatcaccgacatcgccgagcgacgctatagcgat
gtccatctctcggcgttcgtcacggcctgctcagcggtcccgctcgatacggacgaaacg
atcagcctgaccagggcgatggtcgatgtcggcgagcgattgcagtggcccggaacggtc
atcgtcgacaagcatggcgtcggtggcttgccgggcaatcgcaccacgccgatcatcgtc
tcgatcatggccgcggagggcctgatcatgcccaagacatcgtcgcgggcgatcacctca
ccggccggcacggcggacacgatggaggtgctggcacctgtcgacctcgacgtttccgca
atccgcaaggtggtcgagcgcgaaggcggctgcatcgcctggggcggcgccgtcaacctc
agccctgccgacgatgtgatcatcggcgtggaacgggtgctcgatatcgatgccgtcggg
cagatggtcgcctcggtgctgtccaagaaaatcgcggccggtgcgacccatctggtcatc
gacatcccggtcgggccgaccgccaaggtacgcggcgccgatgccgccgacacgctcgag
cgggcgctgagctctgtcgcccaagccttcgggcttcgcacgcgcgtgatgcgcggcccc
ggcgccgagccgatcggacggggcatcggtccggcgctcgaggcgcaggatatccttgcc
gtgctccaggggcagccgggcgccgaggatctcgcccaccgggcctgcgagctggcggga
ggactgcttgagctcgcggacgcagccccggcccgcgaaggttatgcgcgtgcgcgggcg
tgcctcgaaagcggccgggcctgggccaagttccaacgtatctgcgaagcgcagggcggc
atgcgggctccaccggtcgcccggttccaacaggatatgatcgctccctatagcggccgc
ctggtgagtatcgacaatcgcaagctcgcgacggtcgcgaagcttgccggcgcgccgatg
gccaaggccgccggcgtcgcgctgcagtgtcggctgaaccagatggtggatgccggggct
cccttgtgtagcattcatgccgagagcccgggcgagctcgactatgcggcggcctatgcg
gtgagcgacgggccgatcttcgggattgaagcgctatga

DBGET integrated database retrieval system