KEGG   Sphingobium chlorophenolicum: Sphch_4197Help
Entry
Sphch_4197        CDS       T01522                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sch  Sphingobium chlorophenolicum
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sch00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sphch_4197
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sphch_4197
  Lipid metabolism
   00071 Fatty acid degradation
    Sphch_4197
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sphch_4197
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sphch_4197
   00626 Naphthalene degradation
    Sphch_4197
Enzymes [BR:sch01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sphch_4197
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pSPHCH01:complement(121014..122039)
Genome map
AA seq 341 aa AA seqDB search
MAKTMKAAVVREFGKPLVIEDAPIPTVGPGQILVKIAATGVCHTDLHAAEGDWPVKPNPP
FIPGHEGVGHVAAVGAGVTHVKEGDRVGVPWLYTACGHCVHCLGGWETLCHEQQNTGYSV
NGSFAEYVLADPNYVGHLPDNVDFLDIAPILCAGVTVYKGLKATEARPGEWVVVSGIGGL
GHMAVQYARAMGLNVAAVDIDDSKLDLATRLGATLTVNAHSEDPSAALKKAIGGAHGALV
TAVSPKAFQQALGMVRRGGTVALNGLPPGDFPLSIFDTVLNGITVRGSIVGTRLDLLEAL
AFAGDGKVKATVHADKLENINDVFSRMHHGDIEGRIVLDLA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaaccatgaaggcggcggtcgtccgcgaattcggcaagcccctggtcatcgag
gacgcgccgatcccgacggtcggccccgggcagatcctggtcaagattgcggcaaccggc
gtgtgccataccgacctgcacgcggcagaaggggactggccggtcaaacccaacccgccc
ttcattcctggccatgaaggcgtcgggcatgtcgccgccgtcggtgcgggcgtcacccat
gtgaaggaaggcgaccgggtcggcgtgccctggctctacaccgcctgcgggcattgcgtg
cattgcctgggtggctgggagacgctttgccacgaacagcagaacaccggctattcggtc
aatggcagctttgccgaatatgtcctcgccgatcccaactatgttggtcaccttcccgac
aatgtcgacttcctcgacattgcgccgatcctctgcgcgggcgtcaccgtctacaaggga
ttgaaggccaccgaggcccgacccggcgagtgggtggtcgtctcagggatcggcgggctc
ggccacatggcggtgcaatatgcccgtgccatgggtctcaatgtggccgcggtcgacatc
gacgatagcaagctcgacctcgctacacgccttggcgccacactgacggtcaacgcgcac
agcgaggacccttcggcagcgctcaagaaggcgataggcggcgcgcacggagcgctcgtc
accgccgtttcgcccaaggcgttccagcaggcgctcggcatggtccggcgcggcggcacg
gtcgcgctcaatggtctgccgccgggcgacttcccgctgtcgatcttcgacaccgtgctg
aacggcattaccgtgcgaggctcgatcgtcggcacgcggctcgatctgctcgaggcactg
gcgttcgccggcgacggcaaggtcaaggccacggtccatgcagacaagctggagaacatc
aacgacgtcttctcccgcatgcaccatggcgacatcgagggccggatcgtcctcgacctc
gcctga

DBGET integrated database retrieval system