KEGG   Streptomyces collinus: B446_01410Help
Entry
B446_01410        CDS       T02787                                 

Definition
(RefSeq) glutathione-independent formaldehyde dehydrogenase
Organism
sci  Streptomyces collinus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(344532..345668)
Genome map
AA seq 378 aa AA seqDB search
MKDVPDAKIEHPCDIIVKITTTNICGSDLHMYEGRTSFESGRTLGHENLGQVVEVGSAVR
KVQVGEYVVLPFNIACGFCKQCEQGLTNYCLTMQPEPALAGAAYGFADMGPYQGGQAELL
RVPYGDFNALRLGEDAAERQTDYVMLADIFPTGYHATEMAHVKPGDQTIVFGAGPVGLMA
TYSALLRGAGRVWTADHQPDRLRKAEEIGAIPINTAEQDPAQVVKEATLGLGADNGCECV
GYQAHDPQGHEDASLTLNGLIDSVRFTGHIGVVGVFLPQDPGGAEAQGELEAQGKVPIDF
GMMWFKGQHMGTGQAPVKRYNRALRDLIAGGKAKPSFVVSHELGLDEAPTAYEHFDARDD
GWTKVVLHPDGHGNGHKR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggacgtaccggacgcgaagatcgagcatccctgcgacatcatcgtcaagatcacc
acgaccaacatctgcggttcggacctgcacatgtacgagggccgcacctcgttcgagtcc
ggccgcaccctggggcacgagaacctgggccaggtggtggaggtcggctcggcggtgcgc
aaggtgcaggtcggcgagtacgtggtcctgcccttcaacatcgcctgcggcttctgcaag
cagtgcgagcagggcctgaccaactactgcctgaccatgcagccggaacccgccctcgcc
ggagcggcctacggtttcgccgacatgggcccctaccagggcggccaggcggagctgctg
cgcgtgccctacggcgacttcaacgcgctgcgtctgggtgaggacgccgccgagcggcag
accgactacgtgatgctcgccgacatcttccccaccggctatcacgccaccgagatggcc
cacgtcaagccgggtgaccagaccatcgtcttcggggccggtccggtcgggctgatggcg
acgtactccgccctcctccggggcgccggccgcgtctggacggccgatcaccagcccgac
cggctgcgcaaggcggaggagatcggggccatccccatcaacaccgccgagcaggacccg
gcgcaggtcgtcaaggaggccaccctcggtctgggcgccgacaacggctgcgaatgcgtc
ggttaccaggcccacgacccccagggccacgaggacgccagtctcacgctcaacggcctg
atcgactcggtcaggttcaccggccacatcggcgtggtgggcgtgttcctgccccaggac
cccggcggcgcggaggcccagggcgagctggaggcgcagggcaaggtccccatcgacttc
ggcatgatgtggttcaagggccagcacatggggaccgggcaggcgccggtgaagaggtac
aaccgggccctgcgggacctgatcgccggcgggaaggcgaagccgagcttcgtcgtctcc
cacgaactcggcctggacgaggcccccaccgcctacgagcacttcgacgcccgtgacgac
ggctggaccaaggtggtcctgcaccccgacggacacggcaacggccacaagcggtag

DBGET integrated database retrieval system