KEGG   Streptomyces collinus: B446_05960Help
Entry
B446_05960        CDS       T02787                                 

Definition
xylose isomerase
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
sci  Streptomyces collinus
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sci00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:sci00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1435049..1436215)
Genome map
AA seq 388 aa AA seqDB search
MSYQPTPDDRFTFGLWTVGWQGRDPFGDATRRALDPVESVQRLAELGAHGVTFHDDDLIP
FGSSDTERESHVKRFRQALDATGMRVPMATTNLFTHPVFKDGAFTANDRDVRRYALRKTI
RNIDLAAELGARTYVAWGGREGAESGAAKDVRAALDRMKEAFDLLGEYVTSQGYDIRFAI
EPKPNEPRGDILLPTVGHALAFIERLERPELYGVNPEVGHEQMAGLNFPHGIAQALWAGK
LFHIDLNGQSGIKYDQDLRFGAGDLRAAFWLVDLLESAGYDGPRHFDFKPPRTEDLDGVW
ASAAGCMRNYLILKERAAAFRADPEVQDALRASRLDELAQPTAADGLQALLGDRSAFEDF
DVEAAAARGMAFEHLDQLAMDHLLGARG
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgagctaccagcccacccccgacgacaggttcaccttcggcctgtggaccgtcggctgg
cagggaagggacccgttcggcgacgccacccgccgcgccctcgacccggtcgagtcggtg
cagcgactggccgagctcggcgcccacggcgtcaccttccacgacgacgacctgatcccc
ttcggctcttcggacaccgagcgcgaatcgcacgtcaagcggttccgccaggccctggac
gcgaccggcatgcgcgtcccgatggccaccaccaacctcttcacgcacccggtcttcaag
gacggcgcgttcacggccaacgaccgggacgtgcgccgctacgcgctgcgcaagaccatc
cgcaacatcgatctggccgccgaactgggtgcgcgcacctacgtcgcctggggcggccgt
gagggcgccgagtccggtgccgccaaggacgtgcgcgccgccctcgaccggatgaaggag
gccttcgacctcctcggcgagtacgtcacctcgcagggctacgacatccgtttcgccatc
gagcccaagccgaacgagccgcgcggcgacatcctgctgcccaccgtcggccacgccctg
gccttcatcgagcgcctggagcgcccggagctctacggcgtcaacccggaggtcggccac
gagcagatggccgggctgaacttcccacacggcatcgcacaggccctgtgggcgggcaag
ctcttccacatcgacctcaacgggcagtccggcatcaagtacgaccaggacctgcggttc
ggcgcgggcgacctgcgggcggccttctggctcgtcgacctcctggagagcgccggttac
gacgggccccgccacttcgacttcaagccgccgcggaccgaggacctggacggcgtgtgg
gcgtcggcggccggctgcatgcgcaactacctgatcctgaaggagcgtgcggccgccttc
cgcgccgacccggaggttcaggacgcgctgcgcgcctcacgtctggacgagctggcgcag
ccgacggcggcggacggcctgcaggccctgctcggcgaccgctccgccttcgaggacttc
gacgtggaggccgccgccgcgcgcggcatggccttcgaacacctcgaccagctggcgatg
gaccacctgctgggcgcccgcggctga

DBGET integrated database retrieval system