KEGG   Streptomyces collinus: B446_06640Help
Entry
B446_06640        CDS       T02787                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sci  Streptomyces collinus
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:sci00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    B446_06640
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    B446_06640
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    B446_06640
Enzymes [BR:sci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     B446_06640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1582465..1584051
Genome map
AA seq 528 aa AA seqDB search
MSDRQFPGRRSVLRGSLAASAALTLPAGLGAAPAFARSGRPEAGWGVQTGDVTTDGGLVW
VRADRPARMIVETSATESFRAPRRWQGPLLGAGTDFTGTTRLHGLPSGEQIHYRVLLADP
DDPRRTGEPVTGTFRTVSRRRRDGVRFLWSGDLAGQGWGINPDRGGYRIYDAMARLDPDF
FLCSGDNIYADGPIAATQALPDGGTWRNVTTEEKAKVAETLAEFRGNFRYNLLDANLRRF
NAQVPSVVQWDDHEVRNNWYPGEVIATTDTRYTEKSVDVLAARARRAFGEYFPISTLRQG
AKEGRVHRVLRQGPLLDVFVLDMRTYRDANSPDDQTVDPQGIMGREQLEWLKRELSRSRA
VWKVIAADMPIGLVVPDTTEGRPNFEAVAQGDPGVPLGRELQIAELLRFVKHRRITGTVW
LTADVHHTSAQHYQPSRAAFTDFEPFWEFVSGPLNAGAFPAGALDGTFGPERVFVKAPTA
SNVSPAGGFQFFGEVDIDGDSGELTVRLREQDGTVLFTRTLRPGLVGQ
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaccgtcagttccccggccgccgcagcgtgctgcgcggctcgctcgccgcgtcg
gcggccctgaccctgccggcgggcctcggcgccgcaccggcgttcgcccgttccggccgg
cccgaggcgggctggggcgtgcagacgggcgacgtgaccaccgacgggggcctggtgtgg
gtccgcgcggaccgcccggcccggatgatcgtggagacgtcggccaccgagtcgttccgc
gccccgcgccgctggcagggcccgctgctgggcgcaggcacggacttcaccggcaccacc
cggctgcacggcctgccctccggggagcagatccactaccgcgtcctgctcgcggacccg
gacgacccgcgccgtaccggcgagcccgtgaccggcaccttccgcaccgtctcccggcgc
cgccgggacggcgtgcgcttcctgtggtcgggcgacctggccggccagggctggggcatc
aaccccgaccggggcggctaccgcatctacgacgcgatggccaggctcgatcccgacttc
ttcctgtgcagcggcgacaacatctacgcggacggcccgatcgccgcgacacaggccctg
ccggacggcggcacctggcggaacgtcaccaccgaggagaaggcgaaggtcgccgagacg
ctcgcggagttccggggcaacttccgctacaacctgctcgacgcgaacctgcgccggttc
aacgcccaggtgccctccgtcgtccagtgggacgaccacgaggtccgcaacaactggtac
ccgggcgaggtgatcgccaccacggacacccggtacacggagaagagcgtcgacgtgctc
gccgcccgcgcccggcgggcgttcggcgagtacttcccgatctccacgctgcggcagggc
gcgaaggagggccgcgtccaccgcgtgctgcgccagggcccgctgctggacgtgttcgtg
ctggacatgcggacctaccgcgacgccaactcccccgacgaccagaccgtcgacccgcag
ggcatcatgggccgggagcagttggagtggctcaagcgtgagctgtcccgttcgcgcgcg
gtgtggaaggtgatcgccgcggacatgccgatcgggctcgtcgtgcccgacacgacggag
ggccggccgaacttcgaggcggtggcgcagggcgacccgggcgtcccgctcggccgtgag
ctgcagatcgcggagctgctgcggttcgtcaagcaccggcggatcaccggcaccgtgtgg
ctgacggcggacgtgcaccacacctccgcgcagcactaccagccgtcgcgggccgcgttc
accgacttcgagccgttctgggagttcgtctccgggccgctgaacgccggtgcgttcccg
gccggcgcgctggacggcacgttcggtcccgagcgggtgttcgtgaaggcgccgaccgcg
tcgaacgtctcgcccgccggcgggttccagttcttcggcgaggtcgacatcgacggcgac
agcggcgagctgacggtccggctgcgcgagcaggacggcaccgtgctgttcacgcggacg
ctgcggcccggcctggtcgggcagtag

DBGET integrated database retrieval system