KEGG   Streptomyces collinus: B446_11135Help
Entry
B446_11135        CDS       T02787                                 

Definition
(GenBank) esterase/lipase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
sci  Streptomyces collinus
Brite
Enzymes [BR:sci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     B446_11135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Abhydrolase_3 DLH Thioesterase Esterase_phd Peptidase_S9 UPF0227 Abhydrolase_5 Ser_hydrolase Abhydrolase_2 BAAT_C Esterase Lipase_3
Motif
Other DBs
NCBI-ProteinID: AGS69049
UniProt: S5V1G8
Position
2587130..2587909
Genome map
AA seq 259 aa AA seqDB search
MPVLPGAEPYRHEGGEVGVLLCHGFTGSPQSLRPWAEHHAAHGLTVSVPLLPGHGTRWED
MQVTGWQDWYAEVNRELRLMSERCSRVFVGGLSMGGALALRLAARHGERVAGVVVVNPAN
RVNGLSAYALPVARHLVRTTKGIASDIARGGSAELGYDRVPLHAAHSLRVFLRRLDGELP
QVTQPLLLLRSARDHVVPAADAARVLSRVSSLDVTGIVLEQSYHVATLDHDADRIFEESL
AFMGRLAPSVGKEGTAAVG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgccggttctccccggagccgagccgtaccgccacgagggcggggaggtgggtgtcctc
ctctgtcacggcttcaccggctcgccccagtcgctgcgcccctgggcggagcaccacgcg
gcgcacggcctgaccgtgtcggtgccgctgctgcccgggcacggcacccgctgggaggac
atgcaggtgacgggctggcaggactggtacgcggaggtgaaccgcgagctgcgcctgatg
tccgagcgttgttcccgggtcttcgtcggtggcctgtccatgggcggcgcgctggcgctg
cggctggcggcccggcacggcgagcgggtcgccggggtggtcgtcgtcaacccggcgaac
cgggtgaacggcctgtcggcgtacgcccttccggtggcccggcacctcgtacggacgacg
aagggcatcgccagtgacatcgcccggggcgggtcggcggagctggggtacgaccgggtc
ccgctgcacgcggcgcactccctgcgggtgttcctgcgccggctggacggcgagctgccc
caggtcacccagccgttgctgctgctgcgcagcgcccgggaccacgtggtcccggcggcc
gacgcggcgcgggtgctgagccgggtgtcctccctggacgtgaccgggatcgtgctggaa
cagagttaccacgtggcgacgttggaccacgatgcggaccggatcttcgaggagagcctc
gccttcatgggccggctcgcacccagtgtcggcaaggaagggacggccgcagttggctga

DBGET integrated database retrieval system