KEGG   Streptomyces collinus: B446_11135Help
Entry
B446_11135        CDS       T02787                                 

Definition
esterase/lipase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
sci  Streptomyces collinus
Brite
Enzymes [BR:sci01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     B446_11135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2587130..2587909
Genome map
AA seq 259 aa AA seqDB search
MPVLPGAEPYRHEGGEVGVLLCHGFTGSPQSLRPWAEHHAAHGLTVSVPLLPGHGTRWED
MQVTGWQDWYAEVNRELRLMSERCSRVFVGGLSMGGALALRLAARHGERVAGVVVVNPAN
RVNGLSAYALPVARHLVRTTKGIASDIARGGSAELGYDRVPLHAAHSLRVFLRRLDGELP
QVTQPLLLLRSARDHVVPAADAARVLSRVSSLDVTGIVLEQSYHVATLDHDADRIFEESL
AFMGRLAPSVGKEGTAAVG
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
gtgccggttctccccggagccgagccgtaccgccacgagggcggggaggtgggtgtcctc
ctctgtcacggcttcaccggctcgccccagtcgctgcgcccctgggcggagcaccacgcg
gcgcacggcctgaccgtgtcggtgccgctgctgcccgggcacggcacccgctgggaggac
atgcaggtgacgggctggcaggactggtacgcggaggtgaaccgcgagctgcgcctgatg
tccgagcgttgttcccgggtcttcgtcggtggcctgtccatgggcggcgcgctggcgctg
cggctggcggcccggcacggcgagcgggtcgccggggtggtcgtcgtcaacccggcgaac
cgggtgaacggcctgtcggcgtacgcccttccggtggcccggcacctcgtacggacgacg
aagggcatcgccagtgacatcgcccggggcgggtcggcggagctggggtacgaccgggtc
ccgctgcacgcggcgcactccctgcgggtgttcctgcgccggctggacggcgagctgccc
caggtcacccagccgttgctgctgctgcgcagcgcccgggaccacgtggtcccggcggcc
gacgcggcgcgggtgctgagccgggtgtcctccctggacgtgaccgggatcgtgctggaa
cagagttaccacgtggcgacgttggaccacgatgcggaccggatcttcgaggagagcctc
gccttcatgggccggctcgcacccagtgtcggcaaggaagggacggccgcagttggctga

DBGET integrated database retrieval system