KEGG   Streptomyces collinus: B446_11680Help
Entry
B446_11680        CDS       T02787                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sci  Streptomyces collinus
Pathway
sci00500  Starch and sucrose metabolism
sci01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B446_11680
Enzymes [BR:sci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     B446_11680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Alpha-amylase_C Bac_rhamnosid_N
Motif
Other DBs
NCBI-ProteinID: AGS69158
UniProt: S5UQ17
Position
complement(2708661..2710037)
Genome map
AA seq 458 aa AA seqDB search
MARSTLPMALAVAAAFTIGMYPTTAAASPPGTKDVTAVLFEWNYASVAKECTATLGPAGY
GYVQVSPPAEHIQGSQWWTSYQPVSYRIAGRLGDRTAFQNMVNTCHAAGVKVVVDTVVNH
MAAGSGTGTGGSSYTKYNYPGLYSSPDFDDCTSQVTNYQDRWNVQHCELVGLADLDTGEE
YVRKTIAGYMNDLLTLGVDGFRIDAAKHIPADDLANIKSRLTKPAAYWKQEVIYGAGEAV
QPTEYTGNGDVQEFRYAYDLKRVFNNEKLAYLNNYGEGWGYLSSSVAGVFVDNHDTERNG
STLNYKDGAKYTLANVFMLAWPYGAPDINSGYEWSDADAGPPNGGKVNACWQDGWKCQHA
WPEIKSMVAFRNATRGQSVTNWWDDGNNAIGFGRGSKGYVAINHESSSLTRTYQTSLAAG
TYCNVQNNTTVTVNSNGQFTATLGADTALAIYAGKSGC
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcagcaccctccccatggcgctcgccgtcgcggccgccttcacgattggcatg
tacccgactaccgcggcggcctcgccgcccggcaccaaggacgtcaccgccgtcctcttc
gagtggaactacgcctcggtcgccaaggagtgcaccgccaccctcggcccggccggctac
ggctacgtccaggtctccccgcccgccgagcacatacagggctcgcagtggtggacgtcg
taccagccggtgagctaccggatcgccggccgcctcggcgaccgcacggccttccagaac
atggtgaacacctgccacgcggccggtgtgaaggtcgtggtcgacacggtcgtcaaccac
atggcggcgggcagcggcaccggcaccggcggctcgtcgtacacgaagtacaactacccc
ggtctctactcgagccccgacttcgacgactgcacctcgcaggtcaccaactaccaggac
cgctggaacgtccagcactgcgaactcgtgggcctggccgacctggacacgggcgaggag
tacgtccgcaagaccatcgccggctacatgaacgacctgctgaccctcggcgtggacggc
ttccgcatcgacgcggccaagcacatcccggccgacgacctcgccaacatcaagagccgg
ctcaccaagcccgccgcctactggaagcaggaggtcatctacggcgcgggcgaggcggtc
cagccgaccgagtacaccggcaacggcgacgtccaggagttccgctacgcctacgacctc
aagcgcgtcttcaacaacgagaagctcgcctacctgaacaactacggcgagggctggggc
tacctgagcagttcggtggccggcgtcttcgtcgacaaccacgacaccgaacgcaacggc
tccaccctgaactacaaggacggcgccaagtacaccctggccaacgtcttcatgctggcc
tggccgtacggcgccccggacatcaactcgggctacgagtggtcggacgcggacgccggc
ccgcccaacggcggcaaggtcaacgcgtgctggcaggacggctggaagtgccagcacgcc
tggcccgagatcaagtccatggtcgccttccgcaacgccacccgcggccagtccgtgacc
aactggtgggacgacggcaacaacgccatcggcttcggccggggcagcaagggctacgtg
gccatcaaccacgagtcctcgtccctgacccgcacctaccagacctcgctggcggcgggc
acgtactgcaacgtgcagaacaacacgacggtgacggtgaactcgaacgggcagttcacc
gccaccctgggcgccgacacggcgctcgcgatctacgccgggaagtcgggctgctga

DBGET integrated database retrieval system