KEGG   Streptomyces collinus: B446_14080Help
Entry
B446_14080        CDS       T02787                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sci  Streptomyces collinus
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sci00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    B446_14080
Enzymes [BR:sci01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     B446_14080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3252106..3254250)
Genome map
AA seq 714 aa AA seqDB search
MTAAHEDEPHAHQPHEDEPREDGPLARLAGLHGVATSYRPAPDHTVVVPASAVVAALAAL
GVDAGTPDAVRSALAVRERELRERLLPPTVVHWAGDPGAPAALTALPPGTRLAVETEQGE
ARDGAEGLPLGVHRVTATAPDGRTGQAHLVVAPDRLPALAGRSYGLLVQLYSLLSRRSWG
MGDLGDLAELAGWAGRTAGAGFVQVNPLHAAVPGAPTDPSPYRPSSRRFPDPVHLRIEAI
PEFAHLDDPADRARLQELLERAARLRAAVLDKGDLIDRDAVWELKRQALELVLQVPLGPG
RQAAYDAFRAEEGQALEDHATWYALAETYGHDWHRWPEPLRDPRSAATARARAELAARVD
FHSRLAWLTDGQLRAAQRTAREAGMPVGIVHDLAVGVHPAGADAWAQGDHFAAGMSVGAP
PDAFNARGQDWGLPPWRPDRLAASGYAPFRRLLRALFRYAGALRIDHVMGLFRLWWVPQG
SPPTEGTYVRYDAEAMLAVLALEASRAGAVVIGEDLGTVEPGVRETLQRRGVLGTSVLWF
ERDWEGDGRPLPPERWRADCLATATTHDLPPTAARLTGDHVELRDRLGLLTRPAAEERAE
ATADAAEWLALLGSLGLLDSPAAGPPGSDEQAEIEGVHRFLLRTPARLIGVWLPDGVGDR
RPQNLPGTWDQYPNWRLPVAGPDGRPLTLEELTASPRLRALLEVCRAGEGAGAL
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcggcgcacgaggacgagccgcacgcgcaccaaccgcacgaggacgagccgcgg
gaggacggaccgctggcccggctcgccgggctgcacggcgtcgccacctcctaccgcccc
gccccggaccacacggtcgtggtccccgcctccgccgtggtcgccgccctggccgccctc
ggcgtcgacgcgggcaccccggacgccgtccgttccgcgctcgccgtgcgggagcgcgag
ctgcgcgagcggctgctgccgccgacggtcgtgcactgggccggtgacccgggcgcaccg
gccgctctcaccgcgctgccccccggcacccggctggccgtcgagaccgagcagggcgag
gcgcgggacggcgccgagggcctgccgctcggcgtgcaccgggtgaccgccaccgccccg
gacggccgcaccggccaggcccatctcgtcgtcgcgccggaccggctgcccgctctcgcc
ggccgttcctacggcctcctcgtccagctctactcgctgctgtcgcggcgctcctggggc
atgggcgacctcggtgacctggccgagctggccggctgggccggacgcaccgcgggcgcc
ggcttcgtgcaggtcaacccgctgcacgcggccgtgcccggagccccgaccgacccgtcc
ccgtaccggccgtcctcgcgccgcttccccgatcccgtgcacctgcggatcgaggcgatc
cccgagttcgcccacctcgacgatcccgcggaccgcgcccggctccaggaactgctggag
cgcgccgcacggctgcgcgccgccgtcctcgacaagggcgacctcatcgaccgggacgcg
gtgtgggagctgaaacggcaggccctcgagctggtcctgcaggtcccgctcggaccgggg
cggcaggccgcctacgacgccttccgcgccgaggagggacaggcgctggaggaccacgcc
acctggtacgccctcgccgagacgtacggccacgactggcaccggtggcccgagccgctg
cgcgacccccgctccgccgcgaccgcgcgggcccgggccgagctggccgcacgcgtcgac
ttccactcccgcctcgcctggctcaccgacggccagctccgcgccgcccagcgcaccgcc
cgcgaggccggcatgcccgtcgggatcgtgcacgacctcgccgtcggggtgcacccggcg
ggcgccgacgcctgggcgcagggggaccacttcgccgccgggatgtccgtcggcgccccg
cccgacgcgttcaacgcgcgcggccaggactgggggctgccgccctggcgccccgaccgc
ctcgccgcctccgggtacgcccccttccgccggctcctgcgcgccctcttccgctacgcc
ggcgccctgcgcatcgaccacgtgatgggcctgttccggctctggtgggtgccccagggc
agcccgcccaccgagggcacctacgtccgctacgacgccgaggccatgctggccgtgctc
gccctggaggcctcccgcgccggggcggtggtgatcggcgaggacctgggcaccgtggag
cccggggtccgcgagacgctccagcggcgcggggtgctcggcacctccgtgctctggttc
gagcgggactgggagggcgacggccgtccgctgccgccggagcgctggcgcgccgactgc
ctggccaccgccaccacccacgacctgccgccgaccgcggcccggctcaccggcgaccac
gtcgagctgcgcgaccgcctcggtctgctgacccgcccggccgccgaggagcgcgcggag
gcgaccgcggacgcggcggagtggctggcgctgctgggcagcctcgggctgctggacagt
ccggcggccgggcccccgggctccgacgagcaggcggagatcgagggcgtccaccgtttc
ctgctgcgcaccccggcccggctgatcggcgtctggctcccggacggcgtcggcgaccgg
cggccgcagaacctgcccggcacctgggaccagtacccgaactggcggctgcccgtggcc
ggccccgacggccgtccgctcacgctggaggagctgacggcctcgccgcggctgcgcgcg
ctgctggaggtctgccgggccggggagggggccggggccttgtag

DBGET integrated database retrieval system