KEGG   Streptomyces collinus: B446_14530Help
Entry
B446_14530        CDS       T02787                                 

Definition
carbohydrate kinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sci  Streptomyces collinus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sci00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B446_14530
Enzymes [BR:sci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     B446_14530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3356712..3357614
Genome map
AA seq 300 aa AA seqDB search
MYDYDLLVVGSANADLVIGVERRPAAGETVLGGDLAVHPGGKGGNQAVAAARLGARTALL
ARVGDDAHGRLLLDAQRAAGVDTAGVRVGGAPTGVALITVDPSGDNSIVVSPGANARLTP
ADVRSAAGLVRAARVVSAQLEIPLETVVEVVRTLSPDGRFVLNPSPPRPLPDEVLALCDP
LIVNEHEARVLLGGACEGDDPADWARLLLARGPRSVVVTLGAAGALVCDGSGVNRVPAPK
VDAVDTTGAGDAFTAALAVGLGSGAPLADAAAHAVRVGAAAVTRRGAQESYPTLAEVESL
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtacgactacgacctgctggtcgtgggttcggccaacgccgacctggtgatcggcgtc
gagcggcggccggccgccggcgagaccgtgctcggcggcgacctggccgtccacccgggc
ggcaagggcggcaaccaggcggtcgccgcggcccggctcggagcccgtacggcactgctg
gcccgggtcggcgacgacgcgcacggccggctgctgctggacgcgcagcgggcggccggg
gtggacacggcgggtgtgcgggtgggcggggcgcccacgggcgtcgccctgatcaccgtg
gacccctccggggacaacagcatcgtggtgtcgcccggcgccaacgcccggctcactccg
gcggacgtccgctcggccgccggtctggtccgtgccgcacgggtggtgtcggctcagctg
gagatcccgctggagacggtcgtggaggtcgtacggaccctttccccggacggccgcttc
gtgctgaacccctccccgccgcgcccgctgcccgacgaggtcctggccctctgcgacccg
ctgatcgtgaacgagcacgaggcccgggtcctgctcggcggggcgtgcgagggcgacgac
ccggcggactgggcccggctgctgctggcccgggggccacgctcggtggtggtgaccctg
ggggcggcgggcgcgctggtctgcgacggctcgggggtgaaccgggtgccggcgcccaag
gtggacgcggtcgacaccaccggcgccggtgacgcgttcaccgccgcgctggccgtcggg
ctcggctccggcgcgccgctcgccgacgcggcggcccacgcggtccgggtcggcgcggcg
gcggtgacccgccggggcgcgcaggagtcgtacccgacgctcgcggaggtcgagtcgctg
tga

DBGET integrated database retrieval system