KEGG   Streptomyces collinus: B446_15585Help
Entry
B446_15585        CDS       T02787                                 

Definition
NAD-glutamate dehydrogenase
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
sci  Streptomyces collinus
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:sci00910]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sci00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sci00330]
Metabolism; Metabolism of other amino acids; Taurine and hypotaurine metabolism [PATH:sci00430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3601730..3606667)
Genome map
AA seq 1645 aa AA seqDB search
MQTKLDEAKAELLERAARVAENSPVGGHLPTGTTGEGTAGTPDSESVLAFLQRYYLHTAP
EDLADRDPVDVFSAAVSHHRLAEMRPQGTANVRVHTPSVEENGWTCSHTVVEVVTDDMPF
LVDSVTNELTRQGRGIHVVIHPQFVVRRDVTGKLVEVLATPPTGDLPHDAHTESWIHVEI
DRETDRADLKQITADLLRVLSDVREAVEDWEKMRDAAARIADGLGDEPVPGDLPAPEVEE
ARELLRWLATDHFTFLGYREYQLRDDDTLAAVPGTGLGILRSDPQHAEDDQHPVSPSFER
LPADARAKAREHKLLVLTKANSRATVHRPSYLDYIGVKKFDADGNVVGERRFLGLFSSAA
YTESVRRVPVIRRKVEEVLSLAGFSPNSHDGRDLLQILETYPRDELFQTPPAELQAIATS
VLYLQERRRLRLYLRQDEYGRYYSALVYLPRDRYTTGVRLRIIDILKEELGGISVDFTAW
NTESILSRLHFVVRVPPGTELPELSDSDKERIESRLVEAARSWADAFAEALTAEIGEERA
AEVLRRYNNAFPEGYKADHSPRAAVADLVHLEQLSEDKAFSLSLYEPVGAAPEERRFKIY
QKGGTVSLSHVLPVLSRLGVEVTDERPYEMRCADRTTAWIYDFGLRMPKTTGVGGDLGDD
ARERFQEAFAATWTGKAENDGFNSLVLSAGLDWRQAMVLRAYAKYLRQAGSTFSQDYMED
TLRNNVHTTRLLVSLFEARMSPERQKAGLEITDALLEELDAALDQVASLDEDRILRSFLT
VIKATLRTNFFQEALGGAPHDYVSMKFDPQAIPDLPAPRPAYEIWVYSPRVEGVHLRFGK
VARGGLRWSDRREDFRTEILGLVKAQMVKNTVIVPVGAKGGFVAKQLPDPAVDRDAWLAE
GIASYKTFISALLDITDNMVAGEVVPPQDVVRHDGEDTYLVVAADKGTATFSDIANGVAE
KYNFWLGDAFASGGSAGYDHKGMGITARGAWESVKRHFRELGVDTQTEDFTVVGIGDMSG
DVFGNGMLLSEHIRLVAAFDHRHIFIDPTPDAATSYAERRRLFELPRSSWEEYDTSLLSA
GGGIFPRTAKAIPLNAHIRDALGIEEKVSKMTPADLMKAILHAPVDLLWNGGIGTYVKSS
AESNADVGDKANDAIRVDGQDLRVSVVGEGGNLGLTQLGRIEFAMHGGKINTDAIDNSAG
VDTSDHEVNIKILLNGLVTDGDMTVKQRNKVLAEMTDEVGALVLRNNYAQNVALANALFQ
AKDMLHAQQRFIRHLVREGHLDRALEFLPTDRQIRERLGHGQGLTGPETAVVLAYTKITV
AEELLHTSLPDDPYLRTLLHAYFPSALRERFADAIDNHPLRREITTTVLVNDTVNTGGTT
YLHRLREETGASLEEIVRAQTVARTIFRSAPVWDAVEELDNKVDADVQTRIRLHSRRLVE
RGTRWLLNNRPQPLQLAETIEFFSERVEQVWQQLPKLLKGADLEWYQHVYDELSAAGVPD
ELATRVAGFSSAFPAVDIVSVADRMGKEPLDVAEVYYDLADRLGITQLMDRIIELPRADR
WQSMARASIREDLYAAHAALTADVLAVGNGTSTPEQRFADWEQKNAAILSRARTTLEEIR
GSDSFDLANLSVAMRTMRTLLRTHS
NT seq 4938 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccaagctggacgaagccaaggccgagctgctcgaacgggccgcccgggtagct
gagaacagcccggtcggggggcacctaccgaccgggacgacgggcgagggtacggccggc
actcccgacagcgaatccgtgctcgcgttcctccagcgctactacctgcacaccgcaccc
gaggacctggccgaccgcgacccggtcgacgtcttcagcgccgcggtctcgcaccaccgg
ctggccgagatgcgaccgcagggcaccgcgaacgtgcgggtgcacaccccgagcgtggaa
gagaacgggtggacctgcagccacaccgtggtggaggtcgtcaccgacgacatgcccttc
ctcgtcgactcggtcaccaacgagctgacccggcagggacgcggcatccacgtcgtgatc
cacccccagttcgtggtccggcgcgacgtcaccggcaagctcgtcgaggtgctggcgacc
ccgcccaccggcgacctgccgcacgacgcgcacaccgagtcctggatccacgtcgagatc
gaccgtgagaccgaccgcgccgacctgaagcagatcaccgccgacctgctgcgcgtcctg
tccgacgtccgcgaggccgtcgaggactgggagaagatgcgggacgcggcggcccggatc
gccgacggcctcggcgacgagccggtgccgggcgacctgcccgcccccgaggtcgaggag
gcccgcgagctgctgcgctggctggccaccgaccacttcaccttcctcggctaccgcgag
taccagctgcgcgacgacgacacgctcgccgccgtccccggcaccggtctgggcatactg
cgctcggacccgcagcacgcagaggacgaccagcacccggtcagcccgtccttcgagcgg
ctgcccgccgacgcccgcgccaaggcccgcgagcacaagctgctcgtgctgaccaaggcc
aacagccgggccaccgtgcaccggccgtcgtacctggactacatcggcgtcaagaagttc
gacgcggacggcaacgtcgtcggtgagcgccgcttcctcggcctgttctcctcggccgcc
tacaccgagtccgtgcgccgcgtcccggtcatccgccgcaaggtcgaagaggtcctcagc
ctcgccgggttctcgcccaacagccacgacggccgcgacctgctccagatcctggagacc
tacccgcgcgacgagctgttccagaccccgccggccgagctgcaggccatcgcgaccagc
gtcctgtacctgcaggagcgccgccggctgcggctctacctgcgccaggacgagtacggc
cgctactactcggccctcgtctacctgccccgcgaccgctacacgaccggcgtgcggctg
aggatcatcgacatcctgaaggaggagctcggcggcatcagcgtcgacttcaccgcctgg
aacaccgagtcgatcctgtcccggctgcacttcgtcgtccgggtgccgccgggcaccgag
ctgcccgagctgtccgacagcgacaaggagcgcatcgagtcgcgcctggtcgaggccgcc
cgctcctgggcggacgcgttcgccgaggcgctgaccgccgagatcggcgaggagcgcgcc
gccgaggtgctgcgccgctacaacaacgccttccccgagggctacaaggccgaccactcc
ccgcgtgccgccgtcgccgacctcgtccacctggagcagctcagcgaggacaaggcgttc
tcgctcagcctgtacgagccggtcggcgccgcgcccgaggagcgccgcttcaagatctac
cagaagggcggcacggtctccctgtcgcacgtgctgccggtgctgagccggctgggcgtc
gaggtcaccgacgagcggccgtacgagatgcgctgcgcggaccggacgaccgcctggatc
tacgacttcggcctgcgcatgccgaagacgacgggcgtcggcggggacctgggcgacgac
gcgcgtgagcggttccaggaggcgttcgccgcgacctggaccggcaaggcggagaacgac
ggcttcaactccctcgtgctgagcgccgggctggactggcggcaggcgatggtgctgcgc
gcgtacgccaagtacctgcggcaggccggctccaccttcagccaggactacatggaggac
accctccgcaacaacgtccacaccacccggctgctcgtctcgctgttcgaggcgcggatg
tcgccggagcggcagaaggccgggctggagatcaccgacgccctgctggaggagctggac
gccgctctcgaccaggtggcgagcctggacgaggaccgcatcctgcgttccttcctgacc
gtcatcaaggccaccctgcgcacgaacttcttccaggaggcgctcggcggcgccccgcac
gactacgtgtcgatgaagttcgacccgcaggccatcccggacctgcccgcgccgcgcccg
gcgtacgagatctgggtgtactcgccccgggtcgagggcgtccacctgcgcttcggcaag
gtcgcccgaggcggtctgcgctggtccgaccggcgcgaggacttccgcacggagatcctc
ggcctggtcaaggcacagatggtgaagaacaccgtcatcgtgccggtcggcgccaagggc
ggcttcgtcgccaagcagctgccggacccggcggtcgaccgggacgcgtggctggccgag
ggcatcgccagctacaagacgttcatctcggcgctgctcgacatcaccgacaacatggtg
gccggcgaggtcgtgccgccgcaggacgtggtgcgccacgacggcgaggacacctacctg
gtggtcgcggccgacaagggcaccgcgacgttctccgacatcgccaacggggtcgccgag
aagtacaacttctggctcggcgacgccttcgcctccggcggctcggccggctacgaccac
aagggcatgggcatcaccgcgcgcggcgcctgggagtccgtgaagcggcacttccgcgag
ctgggcgtggacacgcagaccgaggacttcacggtcgtcggcatcggcgacatgtccggt
gacgtgttcggcaacggcatgctgctctccgagcacatccgcctggtcgccgccttcgac
caccggcacatcttcatcgacccgaccccggacgccgccacctcctacgccgagcgacgc
cgcctgttcgagctgccccgctccagctgggaggagtacgacacctcgctgctgtcggcg
ggcggcgggatcttcccccggaccgccaaggcgatcccgctgaacgcgcacatccgggac
gccctgggcatcgaggagaaggtctccaagatgaccccggccgacctgatgaaggcgatc
ctgcacgcaccggtcgacctgctgtggaacggcggcatcggcacctacgtgaagtcgtcg
gcggagtccaacgccgacgtcggcgacaaggccaacgacgccatccgcgtcgacggccag
gacctgcgggtcagcgtcgtcggcgagggcggaaacctgggcctgacccagctcggccgc
atcgagttcgcaatgcacggcgggaagatcaacaccgacgcgatcgacaacagcgccggt
gtggacacctccgaccacgaggtgaacatcaagatcctgctgaacggtctcgtcaccgac
ggcgacatgaccgtcaagcagcgcaacaaggtgctcgccgagatgaccgacgaggtcggc
gcgctggtcctgcgcaacaactacgcgcagaacgtggccctcgccaacgccctgttccag
gccaaggacatgctccacgcccagcagcggttcatccgccacctggtgcgcgagggccac
ctggaccgggcgctggagttcctgcccaccgaccgccagatccgcgagcgcctcggccac
ggccagggcctgacgggcccggagacggccgtcgtgctggcgtacacgaagatcacggtg
gccgaggagctcctgcacacctcgctgccggacgacccgtacctgcgcaccctgctgcac
gcctacttcccgtcggcgctgcgcgagcggttcgccgacgccatcgacaaccacccgctg
cgccgtgagatcaccacgaccgtgctggtcaacgacacggtcaacacgggcggtacgacg
tacctgcaccggctgcgcgaggagaccggcgcctccctggaggagatcgtccgggcgcag
accgtggcccgcacgatcttccgttcggcgccggtgtgggacgcggtcgaggagctggac
aacaaggtcgacgcggacgtccagacccggatcaggctgcactcgcgccgcctggtggag
cgcggcacccgctggctgctgaacaaccggccgcagccgctgcagctcgcggagaccatc
gagttcttctccgagcgggtcgagcaggtctggcagcagctgccgaagctgctcaagggc
gcggacctggagtggtaccagcacgtgtacgacgagctgtccgccgccggtgtcccggac
gagctcgccacccgcgtggccggcttctcctccgccttcccggcggtcgacatcgtctcg
gtggccgaccgcatgggcaaggagccgctggacgtcgccgaggtctactacgacctcgcc
gaccgcctcggcatcacccagctcatggaccgcatcatcgagctgccccgcgccgaccgc
tggcagtccatggcccgcgcctccatccgtgaggacctgtacgcggcccacgcggcgctc
acggcggacgtcctggcggtcggcaacggcacctcgacgcccgagcagcggttcgccgac
tgggagcagaagaacgcggcgatcctgagccgggcgcgtaccaccctggaggagatccgc
ggttcggactccttcgacctcgccaacctgtcggtggcgatgcgcacgatgcggacgctg
ctgcgcacgcactcgtag

DBGET integrated database retrieval system