KEGG   Streptomyces collinus: B446_20060Help
Entry
B446_20060        CDS       T02787                                 

Definition
hydrolase
Orthology
K01556  
kynureninase [EC:3.7.1.3]
Organism
sci  Streptomyces collinus
Pathway
Tryptophan metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sci00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    B446_20060
Enzymes [BR:sci01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     B446_20060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4635050..4636234
Genome map
AA seq 394 aa AA seqDB search
MSELVSRAQELDAADELAPLRSRFVLDDVVYLDGNSLGALPAHVPGRVEDVVRRQWGELR
IRSWEESGWWTAPERIGDRIAPLVGAAPGRIVVGDSTSVNVFKALVAAVRMAGPDRGEVL
VDATTFPTDGYIAESAARLTGRTLRPVTPAELSSALSGRTAAVLLNHVDYRTGRLHDLPG
LTAAVHAHGALAVWDLCHSAGALPVGLDEHGVDLAVGCTYKYLNGGPGSPAYLYVREELQ
ERFDSPLPGWNSHAEPFGMSPSYAPAPGAPRGRVGTPDILSMLALEAALDVWDGVRVEAV
RAKSLALTDFFLECVAAYTEPGRVESVTPLPHAERGSQIALRCADAGEVMKRLIDRGVVG
DFRHPDVLRFGFTPLYVGFADTERAARVLGEVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagctggtctcgcgcgcgcaggagctggacgcggccgacgagctggccccgctg
cgctcccgcttcgtcctggacgacgtggtctacctggacggcaactccctgggcgcgctc
cccgcgcacgtgccgggccgggtcgaggacgtcgtccgcaggcagtggggcgagctgcgc
atccggtcctgggaggagagcggctggtggacggcgcccgagcggatcggcgaccgcatc
gccccgctggtcggcgcggccccgggccggatcgtggtgggcgactcgaccagcgtcaac
gtcttcaaggcgctggtggcggccgtccgcatggccggcccggaccgtggcgaggtcctg
gtcgacgcgacgacgttccccacggacggctacatcgccgagtcggcggcccggctgacc
ggccgcaccctgcgcccggtgacgccggccgagctgtcgtcggcgctgtccgggcgtacg
gcggcggtgctgctgaaccacgtcgactaccgcaccggccgcctgcacgacctgcccggc
ctgacggccgcggtccacgcccacggcgcgctcgcggtctgggacctgtgccacagcgcg
ggcgcgctgccggtggggctggacgagcacggggtcgacctggcggtcggctgcacctac
aagtacctgaacggcggcccgggttcgccggcgtacctgtacgtgcgcgaggagctccag
gagcggttcgactcgcccctgcccggctggaactcgcacgccgagcccttcgggatgagc
ccgtcgtacgccccggcgcccggtgcgccgcgcggccgggtcggcacgccggacatcctg
tccatgctggccctggaggcggccctggacgtctgggacggtgtgcgggtcgaggcggtg
cgggcgaagtcgctcgcgctgacggacttcttcctggagtgcgtcgccgcgtacaccgag
ccgggccgggtcgagtccgtgaccccgctgccgcacgcggagcggggcagccagatcgcc
ctgcgctgcgccgacgcgggcgaggtgatgaagcgtctgatcgaccgcggtgtggtgggc
gacttccgccacccggacgtcctgcgcttcggtttcaccccgctgtacgtcggcttcgcc
gacaccgagcgggcggcccgggtgctgggcgaggtgctcggctag

DBGET integrated database retrieval system