KEGG   Streptomyces collinus: B446_22945Help
Entry
B446_22945        CDS       T02787                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sci  Streptomyces collinus
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sci00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5272519..5273796
Genome map
AA seq 425 aa AA seqDB search
MDAISVIRSKRDRGELTDEQIDWVIDAYTRGEVADYQMAALNMAILLNGMNRREISRWTA
AMIASGERMDFSSLSRPTADKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRALLSNEEMLHVLDTTGAVICAAGDGLAPADKKLYALRDVTGTVEAIPLI
ASSIMSKKIAEGTGSLVLDVKVGSGAFMKTIEDARELAATMVGLGTDHGVKTVALLTDMA
TPLGLTAGNALEVRESVEVLAGGGPADVVELTVALAREMLDAAGVKDADPAKALADGSAM
DVWRRMIAAQGGDPDAELPTSKEQHVVKAPSSGVLTRLDAYDIGVAAWRLGAGRARKEDP
VQAGAGVEMHAKPGDTVTAGQPLLTLHTDTPERFDYALQAVEGSYDIAAPGTDFTASPVV
LERIA
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatctccgtcatccgcagcaagcgggaccgcggtgagctgaccgacgagcag
atcgactgggtcatcgacgcgtacacccgcggcgaggtcgccgactaccagatggccgcg
ctcaacatggcgatcctgctcaacggcatgaaccgccgcgagatctcccgctggaccgcg
gccatgatcgcctccggcgagcgcatggacttctcctcgctctcccgccccacggcggac
aagcactccaccggcggcgtcggcgacaagatcaccctcccgctcgccccgctcgtcgcg
gcctgcggcgcggccgtcccgcagctctcgggccgcggcctcggccacaccggcggcacc
ctggacaagctggagtccatccccggctggcgggccctgctctccaacgaggagatgctg
cacgtcctggacaccacgggcgcggtgatctgcgccgcgggcgacggcctcgccccggcc
gacaagaagctgtacgccctgcgcgacgtcaccggcacggtcgaggcgatcccgctgatc
gcctcctcgatcatgtcgaagaagatcgccgagggcaccggctcgctggtcctggacgtg
aaggtcggcagcggcgccttcatgaagacgatcgaggacgcgcgggagctcgccgcgacg
atggtcggcctcggcaccgaccacggcgtgaagacggtcgcgctcctcacggacatggcc
acccccctcggcctgaccgcgggcaacgccctcgaggtccgcgagtcggtcgaggtcctg
gccggcggcggtcccgcggacgtcgtggagctgacggtcgcgctggcccgcgagatgctg
gacgcggccggggtcaaggacgccgacccggcgaaggcgctggccgacggctccgcgatg
gacgtctggcggcggatgatcgccgcccagggcggcgacccggacgccgagctgcccacg
tcgaaggagcagcacgtcgtcaaggcgccgtcctccggtgtgctgacccgcctggacgcc
tacgacatcggcgtcgccgcctggcgcctcggcgcgggccgggcccgcaaggaggacccg
gtgcaggccggcgcgggcgtcgagatgcacgccaagccgggcgacacggtgaccgcgggc
cagcccctgctgaccctgcacaccgacaccccggagcgcttcgactacgccctccaggcg
gtcgagggctcctacgacatcgcggccccgggcaccgacttcacggcgtcgccggtcgtg
ctggaacgtatcgcctga

DBGET integrated database retrieval system