KEGG   Streptomyces collinus: B446_25955Help
Entry
B446_25955        CDS       T02787                                 

Definition
glycosyl hydrolase
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
sci  Streptomyces collinus
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sci00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    B446_25955
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    B446_25955
Enzymes [BR:sci01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     B446_25955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5974481..5976349)
Genome map
AA seq 622 aa AA seqDB search
MRTPLRTTRLLLAGLLAAAGLTTLGAPSAHAAGEQVTAWLTTTDDSAGRHVVRGLQAQTP
FAFQSGTGGGGENITVDENTRYQTFTGGGASFTDTAAWLMNSSGALSASTRDATMRKLFS
PSDGIGLSFLRNPMGASDLARYGYTYDDVPAGQTDTSLARFSLAHDLADVVPLTRQALQL
DPALTVMASPWTAPAWMKDSGSLNGGWLKAEDYGAYASYFVKYLQAYRDQGVNVSYVTAQ
NEPTCCSGYPSMSWNGNGLAYFTKNELLPKLQAAGLTTKVLAHDWNWDVYDSYAAQTVDD
PAVRNHPNFGGIAWHGYGGDIGKQTSVHDQYPTLDAFGTEHSGGTWIADQQREDMSNIID
YTRNWAKSVTKWSLAVDQNMGPHNGGCGTCTGLVTVHNGDGASGTVDYTVEYYDMGHLTK
FVRPGAQRIASTASTTVPNVAWRNPDGSKALIAYNGSSSARSVTVNWGAQHATYSLPGRT
SATFTWSGTQSGGGGRSGAFVGLAGKCLDVAGASSANGASVQLYDCNGSTAQQWTLPGDG
SVRALGKCLDVTSASTADGAKVQLYDCNGTGAQKWSYDASTGDVVNTAANKCLDVTDNSS
ANGTRAQIWSCTGAANQKWKLQ
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgagaacccccctgcgcaccacccggctgctgctggccggcctgctggccgccgccggg
ctgacgaccctcggcgcaccgtccgcgcacgcggccggcgaacaggtcaccgcgtggctc
accaccaccgacgactccgccggacggcacgtcgtacgcggtctccaggcccagacgccg
ttcgccttccagtccggcaccggtggcggcggcgagaacatcaccgtcgacgagaacacc
cgctaccagaccttcaccggcggcggcgcgtccttcacggacaccgccgcctggctgatg
aacagcagcggggcgctgtccgcgagcacccgggacgcgaccatgcgcaagctgttctcg
ccgtcggacgggatcgggctgtcgttcctgcgcaaccccatgggcgcctcggacctggcg
cggtacgggtacacctacgacgacgtgcccgcgggccagaccgacacctcgctggccagg
ttctccctcgcgcacgacctcgcggacgtcgtcccgctgaccaggcaggcactgcagctc
gacccggccctgacggtgatggcctcgccgtggacggcccccgcctggatgaaggacagc
ggctcgctcaacggcggctggctgaaggccgaggactacggcgcgtacgcctcctacttc
gtgaagtacctccaggcgtaccgggaccagggcgtgaacgtctcctacgtcaccgcgcag
aacgagccgacctgctgttccggctacccgtcgatgagctggaacgggaacgggctggcg
tacttcaccaagaacgagctgctgccgaagctgcaggcggcggggctcaccaccaaggtc
ctggcgcacgactggaactgggacgtctacgactcctacgccgcccagacggtggacgac
ccggccgtgcgcaaccaccccaacttcggcgggatcgcctggcacggctacggcggtgac
atcggcaagcagacgagcgtgcacgaccagtaccccacgctggacgccttcggcaccgag
cactccggcggcacctggatcgccgaccagcagcgcgaggacatgtccaacatcatcgac
tacacgcgcaactgggcgaagtcggtgaccaagtggtcgctcgcggtggaccagaacatg
ggcccgcacaacggcggctgcggcacctgcaccggcctggtcaccgtgcacaacggggac
ggcgcgagcgggacggtcgactacaccgtcgagtactacgacatgggccacctgacgaag
ttcgtccgcccgggcgcccagcgcatcgcctccacggcctcgaccaccgtgcccaacgtg
gcgtggcgcaacccggacggcagcaaggcgctgatcgcgtacaacggctcgtcgtccgcc
aggtcggtgaccgtcaactggggtgcgcagcacgccacctactcgctgcccggcaggacc
tcggcgaccttcacctggtccggcacccagtcgggcggcggcggccgctccggcgccttc
gtggggctcgcgggcaagtgcctggacgtggcgggcgcgtccagcgcgaacggcgcgtcg
gtgcagctctacgactgcaacggcagcacggcgcagcagtggacgctgccgggcgacggg
tccgtccgggccctcggcaagtgcctggacgtgacctcggcctccaccgcggacggggcc
aaggtccagctgtacgactgcaacggcaccggcgcgcagaagtggtcgtacgacgcgtcc
accggtgacgtggtgaacacggcggcgaacaagtgcctcgacgtcacggacaactcgtcg
gcgaacgggacgcgggcccagatctggtcgtgcacgggcgcggccaaccagaagtggaag
ctccagtag

DBGET integrated database retrieval system