KEGG   Streptomyces collinus: B446_26190Help
Entry
B446_26190        CDS       T02787                                 

Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sci  Streptomyces collinus
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:sci03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6029769..6030629
Genome map
AA seq 286 aa AA seqDB search
MPELPEVEVVRRGLERWVAHRTVADVEVLHPRAVRRHVAGADDFAHRLKGHHIGTPSRRG
KYLWLPLEETNQSVLAHLGMSGQLLVQQHQAPDEKHLRIRVRFADGLGTELRFVDQRTFG
GLSLHDNTPDGLPDVIAHIARDPLDPLFDDEAFAVALRRKRTTVKRALLDQSLISGVGNI
YADEALWRARIHYERPTANLTRPVTAELLGHVRDVMNAALAVGGTSFDSLYVNVNGESGY
FDRSLDAYGREGLPCRRCGTPMRRRPWMNRSSYFCPKCQRPPRVPS
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgcctgagttgcccgaggtcgaggtcgtccggcgcggcctggagcggtgggtcgcccac
cgcacggtcgcggacgtcgaggtgctgcacccgcgcgcggtgcgccggcacgtcgccggc
gccgacgacttcgcgcaccgtctcaagggtcaccacatcggcacgcccagccggcgcggc
aagtacctgtggctgccgctggaggagaccaaccagtccgtcctggcccacctgggcatg
agcggccagctgctggtgcagcagcaccaggcgccggacgagaagcacctgcgcatccgg
gtccggttcgccgacggcctcggcaccgagctgcgcttcgtggaccagcgcaccttcggc
ggcctgtcgctgcacgacaacacccccgacggcctgcccgacgtcatcgcgcacatcgcc
cgcgaccccctggacccgctgttcgacgacgaggcgttcgccgtcgcgctgcgccgcaag
cggaccaccgtcaagcgggccctgctcgaccagtcgctgatcagcggggtcggcaacatc
tacgcggacgaggcgctgtggcgcgcgcgcatccactacgaacgcccgacggcgaacctc
acccgcccggtcacggccgaactgctcggacacgtccgggacgtgatgaacgcggcgctg
gccgtcggcggcaccagcttcgacagcctgtacgtcaacgtcaacggggagtcgggctac
ttcgaccggtccctggacgcgtacgggcgtgagggactgccgtgcaggcggtgcggtacg
ccgatgcggcgccggccgtggatgaaccggtccagctacttctgcccgaagtgtcagagg
ccgccgcgcgtcccgtcgtaa

DBGET integrated database retrieval system