KEGG   Streptomyces collinus: B446_27380Help
Entry
B446_27380        CDS       T02787                                 

Definition
thymidine kinase (EC:2.7.1.21)
Orthology
K00857  
thymidine kinase [EC:2.7.1.21]
Organism
sci  Streptomyces collinus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sci00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    B446_27380
Enzymes [BR:sci01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     B446_27380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6331997..6332647
Genome map
AA seq 216 aa AA seqDB search
MPELVFFSGTMDCGKSTLALQIEHNRSTRGLVGMIFTRDDRAGEGKLSSRLGLVTDAVEV
EDGQDLYAYIVDHLSQGGRADYVIADEAQFLAPGQIDQLARVVDDLGMDVYAFGITTDFR
SKLFPGSQRLVELADRIEVLQVEALCWCGARATHNARTVGGEMVVEGAQVVVGDVNQAAG
EIGYEVLCRRHHRRRMTAATSRAAALSPDVLPVPPA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctggtgttcttctccggaacgatggactgcgggaagtcgaccctggctctg
cagatcgagcacaaccgctccacgcgcggcctcgtcggcatgatcttcacccgggacgac
cgggccggcgagggcaagctgtcctcccgcctcggcctggtcaccgacgccgtggaggtc
gaggacggccaggacctgtacgcgtacatcgtcgaccacctgtcccagggcggccgcgcg
gactacgtgatcgcggacgaggcgcagttcctggcacccgggcagatcgaccagctcgcg
cgcgtggtggacgacctcggcatggacgtgtacgccttcgggatcaccaccgacttccgc
tccaagctcttccccggctcccagcggctggtggagctggccgaccgcatcgaggtcctc
caggtcgaggcgctgtgctggtgcggcgcccgggccacgcacaacgcccgtacggtcggc
ggggagatggtcgtcgagggcgcccaggtggtcgtcggcgacgtcaaccaggccgcgggc
gagatcggctacgaggtcctgtgccgccgccaccaccgccgccggatgaccgccgcgacg
tcccgcgcggcggccctgtccccggacgtgctgccggtgcccccggcctga

DBGET integrated database retrieval system