KEGG   Streptomyces collinus: B446_28300Help
Entry
B446_28300        CDS       T02787                                 

Definition
protoporphyrinogen oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sci  Streptomyces collinus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sci00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6547933..6549351
Genome map
AA seq 472 aa AA seqDB search
MVGAGVAGLAAAHRLLARGARVTVLEASGRVGGKLLPGEIAGVRVDLGAESMLARRPEAV
ALAREVGLADRLQPPATASASIWTRGALRPMPKGHVMGVPGTAAALAGVLSDEGLARIER
DADLPRTEVGDDVAVGAYVAARLGREVVDRLVEPLLGGVYAGDAYRISLRSAVPQLYQAA
LRHDSLTGAVREIQARAATAGQTGPVFMGIEGGVGSLPLAVAESVRARGGEIVTGAPVTE
LRRADGGTWRVVAQDRVLDADAVVVAVPAPAAAALLRAEAPAAAAELAAVEYASMALVTL
AYRRAQTALPEGSGFLVPPVDGHTIKASTFASHKWGWIADDDPGLLVLRTSVGRYGETEI
LRRDDADLVDLSRHDLREATGLAAEPVAARVTRWTDGLPQYPVGHHARVARVRAHVAAVP
GLALCGAHLDGVGIPACVASAYAAADQIQGDLRGVQELTAHPVQSLHGGAGE
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggagcgggggtcgccgggctggcggccgctcaccggctgctcgcgcgcggtgcg
cgggtgaccgtcctggaggcctccgggcgggtcggcggcaagctgctgccgggcgagatc
gcgggcgtacgggtcgacctgggcgccgagtcgatgctcgcccgccgccccgaggccgtg
gccctcgcccgtgaggtgggtctggcggaccggctccagccgccggccaccgcgagcgcc
tcgatctggacccgcggcgccctgcgcccgatgcccaagggccatgtgatgggcgtgccc
ggcaccgccgccgccctggccggcgtgctgtccgacgagggcctggcccgtatcgagcgc
gacgccgacctgccccgcaccgaggtcggcgacgacgtggcggtcggcgcctacgtggcg
gcgcgactcggccgcgaggtcgtcgaccgcctggtggaacccctgctcggcggcgtctac
gcgggcgacgcctaccgcatctcgctgcgctccgccgtcccgcagctctaccaggcggcg
ctgaggcacgactcgctcaccggggcggtccgcgagatccaggcacgcgccgccacggcc
ggccagaccggcccggtgttcatgggcatcgagggcggcgtcggcagcctgccgctcgcc
gtggccgagtcggtccgggcccggggcggcgagatcgtcaccggtgcgccggtgacggag
ctgcgccgcgcggacggcggcacctggcgcgtcgtcgcccaggaccgcgtactcgacgcg
gacgccgtggtcgtcgccgtgcccgccccggccgccgccgcgctgctgcgcgccgaggcc
cccgccgccgcggccgagctcgccgccgtggagtacgcctccatggcgctggtcaccctc
gcctaccgccgcgcgcagacggccctgcccgagggcagcggcttcctcgtgccgcccgtc
gacgggcacaccatcaaggcgtcgaccttcgcctcgcacaagtggggctggatcgccgac
gacgaccccggcctgctcgtcctgcgcacctcggtcggccggtacggcgagacggagatc
ctccggcgcgacgacgccgacctggtggacctctcgcgccacgacctgcgcgaggccacc
ggcctggccgccgaacccgtcgcggcccgcgtcacccgctggaccgacggcctgccccag
taccccgtcggccaccacgcgcgcgtggcccgcgtccgcgcgcacgtcgccgccgtgccg
ggcctcgccctgtgcggcgcgcacctcgacggcgtcggcatcccggcctgcgtcgccagc
gcgtacgcggcggccgaccagatccagggggacctcaggggtgtgcaggagctcaccgca
cacccggtgcagagcctgcacggcggagcgggagaatag

DBGET integrated database retrieval system