KEGG   Streptomyces collinus: B446_29210Help
Entry
B446_29210        CDS       T02787                                 

Definition
aminotransferase AlaT (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sci  Streptomyces collinus
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sci00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    B446_29210
   01230 Biosynthesis of amino acids
    B446_29210
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B446_29210
   00290 Valine, leucine and isoleucine biosynthesis
    B446_29210
Enzymes [BR:sci01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     B446_29210
    2.6.1.66  valine---pyruvate transaminase
     B446_29210
Amino acid related enzymes [BR:sci01007]
 Aminotransferase (transaminase)
  Class I
   B446_29210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6759278..6760486)
Genome map
AA seq 402 aa AA seqDB search
MEFRQSNKLSEVCYEIRGPVIEHADALEAAGHSVLRLNTGNPALFGFEAPEEILQDMIRM
LPRAHGYSDSRGILSARRAVAQRYQNLGLEVDVDDVFLGNGVSELVSMAVTALVEDGDEI
LIPAPDFPLWTAVTTLAGGKAVHYRCDEQADWNPDLADMAAKITDRTKALVLINPNNPTG
AVYPKEVVEGVLDLARRHGLMVFADEIYDQILYDDAVHHSAAALAPDLVVLTFCGLSKTY
RVAGFRSGWLVVTGPRQHARDYLEGLTMLASMRLCANAPAQYAIQAALGGRQSIRELTAP
GGRLREQRDIAWEKLNEIPGVSCVKPKGALYAFPRLDPKVHRIHDDERFVLDLLLREKIQ
VVQGTGFNWPEPDHFRILTLPHAEDLEAAIGRIGRFLGGYRQ
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggagttccggcagtcgaacaagctcagcgaggtctgttacgagatccgcggcccggtg
atcgagcacgccgacgcgctggaggcggcgggccacagcgtgctccggctgaacaccggc
aatcccgcgctcttcggcttcgaggcgccggaggagatcctccaggacatgatccggatg
ctgccccgggcgcacggctacagcgactcgcgcggcatcctctccgcccgccgcgccgtc
gcccagcgctaccagaacctgggcctcgaggtggacgtcgacgacgtgttcctcggcaac
ggcgtctcggagctggtctccatggcggtgacggcgctggtcgaggacggcgacgagatc
ctcatccccgcaccggacttcccgctctggacggcggtgacgaccctcgccggcggcaag
gcggtccactaccgctgcgacgaacaggccgactggaaccccgacctggccgacatggcg
gcgaagatcaccgaccgcaccaaggccctcgtgctgatcaacccgaacaaccccacggga
gccgtgtacccgaaggaggtcgtcgagggcgtcctggacctcgcccgccggcacggtctg
atggtcttcgccgacgagatctacgaccagatcctctacgacgacgccgtccaccactcg
gccgcggccctcgcccccgacctggtggtcctcaccttctgcggcctgtccaagacgtac
cgggtggcgggcttccgctccggctggctggtggtcaccggtccgcggcagcacgccagg
gactacctggagggcctgaccatgctggcctccatgcggctgtgcgccaacgcgcccgcc
cagtacgccatccaggccgcgctcggcggccgccagtccatccgtgaactcaccgcgccg
ggcgggcggttgcgcgagcagcgcgacatcgcctgggagaagctgaacgagatccccggg
gtgtcctgtgtgaagcccaagggcgcgctgtacgccttcccgcgcctggacccgaaggtg
cacaggatccacgacgacgagaggttcgtcctcgacctgctgctgcgcgagaagatccag
gtggtccagggcaccggcttcaactggcccgagcccgaccacttccgcatcctcacgctg
ccgcacgcggaggacctggaggcggcgatcggccggatcggacggttcctcggcgggtac
cggcagtga

DBGET integrated database retrieval system