KEGG   Sorangium cellulosum So ce 56: sce0048Help
Entry
sce0048           CDS       T00634                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:4.2.1.17)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:scl01200]
Metabolism; Overview; Fatty acid metabolism [PATH:scl01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:scl00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:scl00650]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:scl00071]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:scl01040]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:scl00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:scl00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:scl00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:scl00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:scl00903]
Metabolism; Metabolism of terpenoids and polyketides; Geraniol degradation [PATH:scl00281]
Metabolism; Xenobiotics biodegradation and metabolism; Caprolactam degradation [PATH:scl00930]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(64837..67065)
Genome map
AA seq 742 aa AA seqDB search
MTTTSAAATPAPAAASPLSLEVRPDGVAVVTYDVPGEAVNTLKPTFTGDLERIAGQIASN
PLIKAAILVSGKADTWIAGADIEMLKGVATAAEAEAMCRAGHEAILRIVRSPKPIVAAIH
GAALGGGLEVALACHARVLSDDRKTVLGLPEVQLGLLPGINGLQRLAERAGLKAALDHGL
TGKNMRPSKARQLGVADDVVPAAILREMAAALALKLARVEAGPPFRPKRASAPKLDSAAL
TRAALERNPIGRALLFQQAARQTRKKTGGHYPAPERIIDVLRTYAEKGFEASKEVEARAF
GELVASSTAHRLMELFFATNAMKKDTGVDDPAVQPRKVEKIAMIGAGLMGAGIAYVSLNA
GISVRLRDRDDASIGRGLKYVADILGERVKKKQLTPLERDEKLALLTATTDGSGLRSADL
VIEAVFEELAVKQAVLRDVEQHGKDGVIFASNTSSIPISRIAAASKRPENVVGMHYFSPV
HKMPLLEVIQTEATSPEVVATAVAVGKRQGKTVIVVNDGVGFYTSRILGPYMNEASWLLA
EGVAVEQVDAALVAWGWPVGPLALLDEVGIDVAAHVGPIMLEAFGDRLAPPPTMARLVSD
DRRGRKNERGMYLYGAAAKKKGKGKHADESVYGVLGLPVPRAKDGPPVPIEEIQLRCSLQ
LVNEALHCLGEGILRSPRDGDIGAIFGLGFPPFRGGPFRYVDGLGAAEVLRRIEIYERRF
GKRWTPAPALVEAARTGKPFYG
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgacatccgccgccgccacgccggcccccgcggccgcgagcccgctctctctc
gaggtgcgccccgacggcgtggccgtcgtcacctacgatgtcccgggcgaggcggtcaac
acgctgaagcccacgttcaccggcgatctcgagcggatcgcgggccagatcgcgagcaac
ccgctcatcaaggcggcgatcctcgtgtccggcaaggccgacacctggatcgcgggcgcc
gacatcgagatgctgaagggcgtcgccacggcggccgaggccgaggcgatgtgccgcgcc
ggccacgaggcgatcctgcggatcgtgcgctcgccgaagccgatcgtcgccgcgatccac
ggcgccgcgctcggcggcggcctcgaggtggcgctcgcctgccacgcccgggtgctgagc
gacgaccggaagacggtgctcggcctgcccgaggtgcagctcggcctgctccccgggatc
aacgggctccagcggctcgcggagcgcgccggcctgaaggcggcgctcgaccacggcctc
accggcaagaacatgcgcccctcgaaggcgcggcagctcggcgtcgccgacgacgtcgtc
cccgcggccatcctgagggagatggccgcggcgctcgcgctcaagctcgcgcgtgtcgaa
gccggcccgccgttccggccgaagcgggcgagcgcgccgaagctcgactccgccgcgctc
acccgcgcggccctggagcggaacccgatcggccgcgccctgctcttccagcaggcagcg
cggcagacgcgcaagaagaccggcgggcactacccggcgcccgagcggatcatcgacgtg
ctgaggacgtatgcggagaagggcttcgaggcgtcgaaggaggtcgaggcgcgcgcgttc
ggcgagctcgtcgcgtcgagcacggcgcaccggctgatggagctcttcttcgcgacgaac
gcgatgaagaaggacaccggcgtggacgaccccgcggtgcagccgaggaaggtcgagaag
atcgcgatgatcggcgccggcctgatgggggccggcatcgcctatgtcagcctgaacgcc
ggcatctccgtgcggctccgggaccgcgacgacgcgtcgatcggccgcgggctcaagtac
gtggccgacatcctcggcgagcgggtgaagaagaagcagctcacgccgctggagcgcgac
gagaagctcgcgctgctcaccgcgacgacggacggctcgggcctccggagcgccgatctg
gtgatcgaggcggtgttcgaggagctcgctgtgaaacaagcggtcctgcgggacgtcgag
cagcacggcaaggacggggtgatcttcgcgtcgaacacgtcgtcgatcccgatctcccgg
atcgcggccgcgtcgaagcggccggagaacgtggtcgggatgcactacttcagcccggtg
cacaagatgccgttgctcgaggtcatccagaccgaggcgacgtcgcccgaggtggtcgcg
acggcggtcgcggtcggcaagcgccagggcaagacggtcatcgtcgtgaacgatggagtc
ggcttctacacgagccggatcctcgggccgtacatgaacgaggcgagctggctgctcgcc
gagggggtcgcggtcgagcaggtcgacgcggcgctcgtcgcgtggggctggccggtcggc
ccgctcgcgctgctcgacgaggtgggcatcgacgtggcggcccacgtcggcccgatcatg
ctcgaggcgttcggcgaccgcctcgcgccgcctcccacgatggccaggctggtgtccgac
gaccggaggggccgcaagaacgagcgcgggatgtacctgtacggcgctgcggcgaagaag
aagggcaagggcaagcacgccgacgagagcgtctatggcgtgctcgggctgccggtgccg
agggcgaaggacggcccgccggtgccgatcgaggagatccagctgcgctgctcgctccag
ctcgtgaacgaggcgctgcactgcctcggcgaggggatcctccggagcccgcgcgacggc
gacatcggcgcgatcttcggcctgggtttcccgccgttccgcggcgggccgttccgctac
gtcgacggcctcggcgccgcggaggtgctccgccgcatcgagatctacgagcgccgcttc
ggcaagcgctggacgcccgccccggccctcgtcgaggcggcgaggaccgggaagcccttc
tacggctga

DBGET integrated database retrieval system