KEGG   Sorangium cellulosum So ce 56: sce0048Help
Entry
sce0048           CDS       T00634                                 

Gene name
fadJ
Definition
multifunctional fatty acid oxidation complex subunit alpha (EC:4.2.1.17)
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:scl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    sce0048 (fadJ)
   01212 Fatty acid metabolism
    sce0048 (fadJ)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    sce0048 (fadJ)
   00650 Butanoate metabolism
    sce0048 (fadJ)
  Lipid metabolism
   00071 Fatty acid degradation
    sce0048 (fadJ)
   01040 Biosynthesis of unsaturated fatty acids
    sce0048 (fadJ)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    sce0048 (fadJ)
   00310 Lysine degradation
    sce0048 (fadJ)
   00380 Tryptophan metabolism
    sce0048 (fadJ)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    sce0048 (fadJ)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    sce0048 (fadJ)
   00281 Geraniol degradation
    sce0048 (fadJ)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    sce0048 (fadJ)
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     sce0048 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     sce0048 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     sce0048 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(64837..67065)
Genome map
AA seq 742 aa AA seqDB search
MTTTSAAATPAPAAASPLSLEVRPDGVAVVTYDVPGEAVNTLKPTFTGDLERIAGQIASN
PLIKAAILVSGKADTWIAGADIEMLKGVATAAEAEAMCRAGHEAILRIVRSPKPIVAAIH
GAALGGGLEVALACHARVLSDDRKTVLGLPEVQLGLLPGINGLQRLAERAGLKAALDHGL
TGKNMRPSKARQLGVADDVVPAAILREMAAALALKLARVEAGPPFRPKRASAPKLDSAAL
TRAALERNPIGRALLFQQAARQTRKKTGGHYPAPERIIDVLRTYAEKGFEASKEVEARAF
GELVASSTAHRLMELFFATNAMKKDTGVDDPAVQPRKVEKIAMIGAGLMGAGIAYVSLNA
GISVRLRDRDDASIGRGLKYVADILGERVKKKQLTPLERDEKLALLTATTDGSGLRSADL
VIEAVFEELAVKQAVLRDVEQHGKDGVIFASNTSSIPISRIAAASKRPENVVGMHYFSPV
HKMPLLEVIQTEATSPEVVATAVAVGKRQGKTVIVVNDGVGFYTSRILGPYMNEASWLLA
EGVAVEQVDAALVAWGWPVGPLALLDEVGIDVAAHVGPIMLEAFGDRLAPPPTMARLVSD
DRRGRKNERGMYLYGAAAKKKGKGKHADESVYGVLGLPVPRAKDGPPVPIEEIQLRCSLQ
LVNEALHCLGEGILRSPRDGDIGAIFGLGFPPFRGGPFRYVDGLGAAEVLRRIEIYERRF
GKRWTPAPALVEAARTGKPFYG
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgacatccgccgccgccacgccggcccccgcggccgcgagcccgctctctctc
gaggtgcgccccgacggcgtggccgtcgtcacctacgatgtcccgggcgaggcggtcaac
acgctgaagcccacgttcaccggcgatctcgagcggatcgcgggccagatcgcgagcaac
ccgctcatcaaggcggcgatcctcgtgtccggcaaggccgacacctggatcgcgggcgcc
gacatcgagatgctgaagggcgtcgccacggcggccgaggccgaggcgatgtgccgcgcc
ggccacgaggcgatcctgcggatcgtgcgctcgccgaagccgatcgtcgccgcgatccac
ggcgccgcgctcggcggcggcctcgaggtggcgctcgcctgccacgcccgggtgctgagc
gacgaccggaagacggtgctcggcctgcccgaggtgcagctcggcctgctccccgggatc
aacgggctccagcggctcgcggagcgcgccggcctgaaggcggcgctcgaccacggcctc
accggcaagaacatgcgcccctcgaaggcgcggcagctcggcgtcgccgacgacgtcgtc
cccgcggccatcctgagggagatggccgcggcgctcgcgctcaagctcgcgcgtgtcgaa
gccggcccgccgttccggccgaagcgggcgagcgcgccgaagctcgactccgccgcgctc
acccgcgcggccctggagcggaacccgatcggccgcgccctgctcttccagcaggcagcg
cggcagacgcgcaagaagaccggcgggcactacccggcgcccgagcggatcatcgacgtg
ctgaggacgtatgcggagaagggcttcgaggcgtcgaaggaggtcgaggcgcgcgcgttc
ggcgagctcgtcgcgtcgagcacggcgcaccggctgatggagctcttcttcgcgacgaac
gcgatgaagaaggacaccggcgtggacgaccccgcggtgcagccgaggaaggtcgagaag
atcgcgatgatcggcgccggcctgatgggggccggcatcgcctatgtcagcctgaacgcc
ggcatctccgtgcggctccgggaccgcgacgacgcgtcgatcggccgcgggctcaagtac
gtggccgacatcctcggcgagcgggtgaagaagaagcagctcacgccgctggagcgcgac
gagaagctcgcgctgctcaccgcgacgacggacggctcgggcctccggagcgccgatctg
gtgatcgaggcggtgttcgaggagctcgctgtgaaacaagcggtcctgcgggacgtcgag
cagcacggcaaggacggggtgatcttcgcgtcgaacacgtcgtcgatcccgatctcccgg
atcgcggccgcgtcgaagcggccggagaacgtggtcgggatgcactacttcagcccggtg
cacaagatgccgttgctcgaggtcatccagaccgaggcgacgtcgcccgaggtggtcgcg
acggcggtcgcggtcggcaagcgccagggcaagacggtcatcgtcgtgaacgatggagtc
ggcttctacacgagccggatcctcgggccgtacatgaacgaggcgagctggctgctcgcc
gagggggtcgcggtcgagcaggtcgacgcggcgctcgtcgcgtggggctggccggtcggc
ccgctcgcgctgctcgacgaggtgggcatcgacgtggcggcccacgtcggcccgatcatg
ctcgaggcgttcggcgaccgcctcgcgccgcctcccacgatggccaggctggtgtccgac
gaccggaggggccgcaagaacgagcgcgggatgtacctgtacggcgctgcggcgaagaag
aagggcaagggcaagcacgccgacgagagcgtctatggcgtgctcgggctgccggtgccg
agggcgaaggacggcccgccggtgccgatcgaggagatccagctgcgctgctcgctccag
ctcgtgaacgaggcgctgcactgcctcggcgaggggatcctccggagcccgcgcgacggc
gacatcggcgcgatcttcggcctgggtttcccgccgttccgcggcgggccgttccgctac
gtcgacggcctcggcgccgcggaggtgctccgccgcatcgagatctacgagcgccgcttc
ggcaagcgctggacgcccgccccggccctcgtcgaggcggcgaggaccgggaagcccttc
tacggctga

DBGET integrated database retrieval system