KEGG   Sorangium cellulosum So ce 56: sce0297Help
Entry
sce0297           CDS       T00634                                 

Gene name
ruvA
Definition
holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:scl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    sce0297 (ruvA)
Enzymes [BR:scl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     sce0297 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(419374..420108)
Genome map
AA seq 244 aa AA seqDB search
MRPRRLRGPDALWRRPPALGRARRHPQVDPARGQGQLIGRLSGHVVEEGDEGTVVLDVSG
VGYEVTVPLGAVGRARGIAANAKAGSDAITLFVHTHVREDALLLYGFATREDRAAFRVLI
GISSIGPKIAMAILSALGAGELAAVITRRETARLTAIPGVGKKTAERLVLELKDKLVHLP
AAPLSPAASPPVATGAKQDLLHSALTRMGYRPAEAERAVTALGARVDSAPLGDLVRDALA
LLSK
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcccccgacggctgcggggacccgatgccctttggcggcgacctcctgccctcggc
agagcgcgacgccatccgcaggtggatccagcaaggggccaaggtcaattgatcggccgg
ctctccggccacgtcgtggaagaaggcgacgagggcacggtcgtcctcgacgtcagcggg
gtcggctacgaggtgaccgtcccgctcggggccgtggggcgcgcgcgcgggatcgccgcg
aacgcgaaggccggctcggacgcgatcaccctgttcgtccacacccacgtgcgcgaggac
gcgctcctcctgtacggcttcgcgacgcgcgaggaccgggcggccttccgcgtgctcatc
ggcatctccagcatcggcccgaagatcgcgatggccatcctcagcgcgctcggcgcgggg
gagctcgccgcggtgatcacccgccgggagaccgcgcgcctcaccgccatccccggcgtc
ggcaagaagaccgccgagcgcctcgtcctcgagctgaaggacaagctcgtccacctcccc
gcggccccgctctcccccgcggcctccccgcccgtggccaccggcgccaagcaggacctc
ctgcacagcgcgctcacccgcatgggctaccgcccggccgaggcggagcgcgccgtcacc
gccctcggcgcgcgcgtcgacagcgccccgctcggcgacctcgtgcgtgatgcgctcgcg
ctcctctccaagtga

DBGET integrated database retrieval system