KEGG   Sorangium cellulosum So ce 56: sce0336Help
Entry
sce0336           CDS       T00634                                 

Gene name
ccpR
Definition
cytochrome c551 peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
scl  Sorangium cellulosum So ce 56
Brite
Enzymes [BR:scl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     sce0336 (ccpR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(474094..475185)
Genome map
AA seq 363 aa AA seqDB search
MLFIAAGLGACERSADYEHKAAPASNTAKPAATAAATSDVKPLVFDPKDVKSFQVLPAKF
ETDKNTITDDKVTLGRMLWYETRLSKNHDISCNSCHGLSTYGVDNKQFSSGHKGQLGGRN
SPSAYNAGPHIAQFWDGRAATLEDQAKGPILNPVEMAMPDEKRVITTLKSIPEYVKLFKA
AFPDDKEPITYDNMAKAIGAFERGLVTPSRFDKFLGGDDKALTAEEKAGFHKFISLGCPT
CHTGVAVGGSTFQKLGLVKEFPGLKDNGRFDHTKDEKDKFFFRVPSLRNVEKTFPYFHDG
SIATLDETVTKMAWHQLGVEAKPEEVKAIVAFLKSLTGDLPTDYIKQPELPPSGPTTPKA
DPT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgctcttcatcgccgccgggctgggcgcctgcgaacgatccgcggactacgagcacaag
gccgccccggcctcgaacacggcgaagcccgccgcgaccgccgcggcgacaagcgacgtg
aagccgctcgtcttcgatccgaaggacgtcaagtccttccaggtcctgcccgcaaaattc
gagacggacaagaacacgatcaccgatgacaaggtgaccctgggaaggatgctgtggtac
gagacgcgcctctcgaagaaccacgatatctcctgcaactcgtgtcatggcctctcgacc
tacggcgtcgacaacaagcagttctcctccgggcacaagggccagctcggcggccgcaac
tcgccctctgcgtacaacgcgggcccccacatcgcccagttctgggacggccgggcggcc
acgctcgaggaccaggccaaagggcctatcctgaaccccgtcgagatggccatgccggac
gagaagcgggtcatcacgacgctcaagtcgatccccgagtacgtgaagctcttcaaggcg
gccttccccgacgacaaggagccgatcacctacgacaacatggccaaggcgatcggcgcg
ttcgagcgcggcctggtcacgccgtcgcgcttcgacaagttcctgggcggcgacgacaag
gcccttaccgccgaggagaaggccgggttccacaagttcatctcgctcgggtgcccgacc
tgccacacgggcgtcgccgtcggcggctcgacgttccagaagctcggcctcgtgaaggag
ttccccggcctcaaggacaacgggcgcttcgaccacacgaaggacgagaaggacaagttc
ttcttccgcgtcccgagcctcaggaacgtcgagaagaccttcccgtacttccacgacggc
tcgatcgcgacgctcgacgagacggtgaccaagatggcgtggcaccagctcggcgtggag
gccaagcccgaagaggtgaaggcgatcgtcgcgttcctcaagtcgctcaccggcgatctc
ccgaccgactacatcaagcagcccgagctgcccccgagcgggccgaccacgcccaaggcc
gacccgacgtga

DBGET integrated database retrieval system