KEGG   Sorangium cellulosum So ce 56: sce0670Help
Entry
sce0670           CDS       T00634                                 

Gene name
cysQ
Definition
inositol monophosphatase CysQ
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
scl  Sorangium cellulosum So ce 56
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:scl00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(954615..955442)
Genome map
AA seq 275 aa AA seqDB search
MDQNDRELDEIVRIARAAAAIVMDVYATPFAVEMKGPGDPVTRADREANALICSALEAAF
PGEAILAEESVPTGDELASRLGKERVFFVDPLDGTREFADRNGEFAVMIGLAVRGRAALG
VVVMPTTGEALAGRAGGAAFLEARDGSRRPLRVSAVSAPADATLIVSRSHRPKEIEPLLA
RLGISKVVPCGSVGVKIARIATGEVDLYVHGGGGAKLWDSCAPEAVLLGAGGSFTDLSGA
PIDYNGPGLKLGRGIIASNGALQAAVVAAARSELG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggaccagaacgacagggagctcgacgagatcgtccgcatcgcgcgcgccgcggcggcg
atcgtgatggacgtgtacgcgacgccgttcgccgtcgagatgaagggccccggcgacccg
gtgacccgcgccgaccgcgaggcgaacgcgctcatctgcagcgcgctcgaggccgcgttc
cccggcgaggcgatcctcgccgaggagagcgtcccgaccggcgacgagctcgcctcgcgc
ctggggaaggagcgggtgttcttcgtcgacccgctcgacggcacgcgggagttcgcggac
aggaacggcgagttcgccgtgatgatcgggctcgcggtccgcggccgcgcggcgctgggc
gtcgtggtgatgcccacgacgggcgaggcgctggccggccgcgccggcggcgccgccttc
ctcgaggcgagggacggcagccggaggccgctccgggtctcggcggtgagcgctccggcc
gacgcgacgctcatcgtctcgcgctcgcaccggccgaaggagatcgagccgctcctcgcg
cggctcggcatctcgaaggtcgtcccctgcggctcggtcggcgtgaagatcgcccggatc
gcgaccggcgaggtcgacctctacgtgcacggcggcggcggcgccaagctctgggacagc
tgcgcgcccgaggccgtgctcctcggggcgggcggcagcttcaccgacctctcgggcgcg
cccatcgactacaacggccccgggctcaagctcggccgcggcatcatcgcctcgaacggc
gccctccaggccgccgtcgtcgccgcggcgaggtcggagctcggctga

DBGET integrated database retrieval system